KEGG   Acinetobacter wuhouensis: BEN71_17580Help
Entry
BEN71_17580       CDS       T05823                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00471  D-Glutamine and D-glutamate metabolism
awu00550  Peptidoglycan biosynthesis
awu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BEN71_17580
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BEN71_17580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:awu01011]
    BEN71_17580
Enzymes [BR:awu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BEN71_17580
Peptidoglycan biosynthesis and degradation proteins [BR:awu01011]
 Precursor biosynthesis
  Amino acid ligase
   BEN71_17580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AXQ23768
UniProt: A0A385C7X0
Position
complement(3538829..3540187)
Genome map
AA seq 452 aa AA seqDB search
MLIQRGGLKVVAGLGISGVSAVNFLHEKGYRVAVTDSREVPPGHDKIPADVQTSFGHFDQ
ELLLQAEEIIISPGLDPKLPEIQAAIAKGIPVISEIQVLRRATDKPIVAITGSNAKSTVT
TLIGLMAQEAGVNVAVGGNLGRPALDLTHDHPDVYILELSSFQLETTSNLNAEVAVVLNM
SEDHLDRHGDMFGYHTAKHRIFQGVKKVVFNRDDSLTRPLVPDVTPMQSFGLNAPDLNQF
GVLKDDDGTIWLARGRERLLKSSEMYIQGTHNVANALACLALGEAIGLSLDKMLETLKTF
KGLEHRCEFVKEVDGVRYYNDSKGTNIGATLAAIDGLGAAIEAQGGKVAIILGGQGKGQD
FTALRDSLQKYAKVAVLIGEDRPIIEKAIEGTTTLIHAESLQEAVELCRQNTHAQDVVLL
SPACASFDMFTGYPQRGHRFVEYVNALEQKES
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgttaatacaacgtggtggtttaaaagttgtggctggacttggaatttcgggtgtttca
gctgtaaattttctacatgaaaaaggctaccgtgttgcagtcactgactctcgtgaagtt
ccgccagggcatgacaaaatccctgctgatgtgcaaaccagttttggacattttgaccaa
gaattattattacaagctgaagaaattatcatcagcccaggactagatccaaaacttcct
gaaattcaagctgcgatcgccaaaggcattcctgttattagtgaaattcaggttttacgc
cgtgcaacagataaacccattgtggcaattacaggctcaaatgcgaaaagtactgtgacg
accttaatcggtctaatggcacaagaagcaggtgtgaatgttgctgtcggtgggaattta
ggtcgtccagctttagatttaactcatgatcatcctgatgtttatattttagaactttca
agcttccaacttgaaaccacgtcgaatctcaatgcagaagtggctgtggttttaaatatg
agtgaagaccatttagaccgtcatggtgatatgtttggttatcacactgcaaaacaccgt
attttccaaggtgttaaaaaagtggtgtttaaccgtgatgattcactgacacgtccactt
gtacctgatgttacaccaatgcaaagctttggcttaaatgcacctgatctcaatcaattt
ggggttttaaaagatgatgatggaacgatttggttagcgcgtggtcgtgagcgcttactg
aaaagctcagagatgtatattcaaggcacacataatgttgccaatgccttagcgtgttta
gcattgggtgaggcgattggtttatctttagataaaatgcttgaaaccttaaaaaccttt
aaaggtttagagcaccgttgtgagtttgtcaaagaagtcgatggtgtacgttattataac
gattctaaagggacgaatattggggcaaccttagctgcgattgatggtcttggtgctgcg
atcgaagcgcaaggtggcaaagttgctattattcttggtggtcaaggtaaagggcaagat
tttacggctttgcgtgattcactacaaaaatatgccaaagttgcggttttaattggtgaa
gatcgtcctattattgaaaaggcaatcgaaggaacaacaacattgattcatgcagaatca
ttgcaagaagcagttgaactttgtcgacaaaatacgcatgcacaagatgtagtgttatta
tcacccgcatgtgcaagttttgatatgtttacaggttatcctcagcgtggtcatcgcttt
gttgaatatgtaaatgctttagagcaaaaagaatcataa

DBGET integrated database retrieval system