KEGG   Alcanivorax xenomutans: P40_01395Help
Entry
P40_01395         CDS       T04770                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00260  Glycine, serine and threonine metabolism
axe00630  Glyoxylate and dicarboxylate metabolism
axe00670  One carbon pool by folate
axe01100  Metabolic pathways
axe01110  Biosynthesis of secondary metabolites
axe01130  Biosynthesis of antibiotics
axe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    P40_01395 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P40_01395 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    P40_01395 (gcvT)
Enzymes [BR:axe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     P40_01395 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: ARB44231
Position
300574..301671
Genome map
AA seq 365 aa AA seqDB search
MGHRTPLYDEHVAAGGKMVDFGGWDMPIHYGSQIEEHHAVRQDAGMFDVSHMTVVDVSGT
GARDYLRRLLANDVDSIETGRALYSGMLNEGGGVIDDLIVYKGDKDYRLVVNCATRDTDL
EWMEQQAGGFAVDIRERPELAMIAVQGPRARAQLAALLDGERHDAVENLPAFAFADCGDW
TIAGTGYTGEDGVEIILPGHHAVALWKQLADAGVRPAGLGARDTLRLEAGMNLYGNDMDG
TVSPLEAAMGWTVKFNEGRDFIGRGALERQKEKGHHRLVGLVLEGKGVLRAHQKVITGDG
EGAEFEGEITSGTFSPTLGKSIALARVPAGTKGQVRVEIRNKHLPAQVVRPPFVRNGKTV
YKSID
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatcgcacaccgctttatgacgaacacgtcgccgctggcggcaaaatggtggat
ttcggcggctgggacatgcccatccactacggctcccagatcgaggagcaccacgccgtg
cgccaggacgccggcatgttcgacgtctcccacatgaccgtggtggacgtctccggcact
ggcgcccgtgactacctgcgccgcctgctcgccaacgacgtcgacagcatcgagaccggc
cgcgccctgtactccggcatgctcaacgaaggcggcggcgtgatcgacgatttgatcgtc
tacaagggcgacaaggattaccggctggtggtaaattgcgccacccgcgacaccgacctg
gaatggatggagcagcaggccggcggcttcgccgtggacatccgcgagcgcccggaactg
gccatgatcgccgtccagggcccgcgggcccgcgcccaactggccgccctgctggacggc
gagcgccatgacgcggtggaaaacctgcccgcgttcgccttcgccgattgcggggactgg
acgattgccggcaccggctatactggcgaggatggcgtggaaatcatcctgcccggccat
cacgcggtggcgctgtggaaacaactggcggacgccggcgtgcgtccggccggcctcggc
gcccgggacaccctgcgtctggaagcgggcatgaacctctacggcaacgacatggacggc
accgtctcgccgctggaagccgccatgggctggaccgtgaagttcaacgaaggccgtgat
ttcatcggccggggcgcgctggagcgccagaaggaaaaaggccaccaccggctggtgggt
ctggtgctggaaggcaagggtgtgctgcgcgcccaccagaaagtcatcaccggggacggc
gaaggagcggagttcgagggtgaaatcaccagcggtactttttcaccgaccctgggcaaa
tccattgccctggcccgggtgcccgccggcaccaaaggccaggtgcgggtggaaatccgc
aacaagcacctgcccgcgcaggtggtacggccgccgttcgtgcgcaacggcaaaacggtt
tataaatcgatcgactga

DBGET integrated database retrieval system