KEGG   Alcanivorax xenomutans: P40_01460Help
Entry
P40_01460         CDS       T04770                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    P40_01460
Enzymes [BR:axe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     P40_01460
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     P40_01460
    1.1.1.-  
     P40_01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ARB44243
Position
316480..317547
Genome map
AA seq 355 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPVVEPGTVGIEVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SKESAPVTMGHEFSGVVYAVGEGVSDIEVGQHVVVEPYIVADDVPTGPGDKYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNDIPLDQAALIEPLSVGHHAFTRSGAKAGDVALVG
GAGPIGLLLSAILKAKGLSVIVTELSSARKQKASESGVADHILDPSEVDVVEEVMKITDG
RGVDVAFECSSVNKVLDTLVAATASAGVVVIVSIWSHPATVNVHSVVMKELDVRGTIAYC
NDHQETIRLVEEGKINLEPFITQRIQLDDLVSKGFDTLIHNNESAVKIIVQPRIS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgtttttatgaccgtggtgatatccgcatcgaggacataccggagccc
gtggtggagcccggtacggtgggtatcgaggtggcatggtgtggcatttgcggtacggat
ttacatgagttcatggaagggccgatctttattcctccctgtggccatccgcatccgatc
tccaaggagtcagcccccgttaccatgggccatgagttttctggtgtggtgtatgccgtg
ggtgagggggtgagcgacatcgaagtcggtcagcatgtggtggtggagccctacatcgtg
gcggatgacgtgcccactgggcccggcgataaatatcatctttccaagaacatgaatttc
atcggcctggggggacggggtggcggcctgtccgagaaaatcgcggttaagcgccgttgg
gtgcacccgatttcaaacgacattccgctggaccaggctgccttgattgagcccctgtcg
gtgggccatcacgccttcacccgcagcggcgccaaggctggcgatgtggcgttggtcggt
ggggcggggcctattggcttactgctgtcagcgattttgaaagccaaagggctgagcgtt
atcgtcacggagctcagcagcgcacgtaagcaaaaagcctccgagtccggtgtcgccgac
catattctggacccctccgaagtagatgtggtcgaggaagtgatgaagatcaccgatggc
aggggcgtggatgtggcgtttgaatgctccagcgtgaacaaagtcctggataccctggtg
gctgcgactgcctccgccggcgtagtggtgattgtgtctatctggagccatccggccacc
gtcaatgtacatagtgtggtaatgaaggagctcgacgtgcgtgggaccattgcgtactgc
aatgaccaccaggaaacgatcaggctggtggaggagggcaagatcaacctggagccgttc
attacccagcgtattcaattggatgatttggtttcaaagggattcgataccctgattcat
aacaatgaatcggcggtgaaaatcattgttcagcctcgaatcagctga

DBGET integrated database retrieval system