KEGG   Alcanivorax xenomutans: P40_02970Help
Entry
P40_02970         CDS       T04770                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
axe  Alcanivorax xenomutans
Brite
KEGG Orthology (KO) [BR:axe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    P40_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ARB44508
Position
complement(624353..625621)
Genome map
AA seq 422 aa AA seqDB search
MEWMLEHSTLMLLIAGGAGFLMALGVGANDVANAMGTSVGARALTVKQAVLIAIVFEFAG
AYLAGGEVTATIRKGIIDAEVFNQTPHYLVYGMLAALLAAGIWLVVASWAGWPVSTTHSI
VGAIVGFAAVGVGMDSVHWGQVGSIVASWVTSPLLAGFLSFALIKSVQKLVLNHDDPFQR
AKKVVPFYMFLVGFVITKVTLVKGLKHVGLEMSFGASTLWAIAGGAVVAGLGVLFLSRIQ
PDPEADKDFRFSSVERVFAVLMIFTACAMAFAHGSNDVANAVGPLAAISSVLANGGVIGK
EAIIPSWVLLVGAMGIVFGLAVLGARVMATVGTKITELTPSRGFAAELGAATTVVLASGT
GLPISTTHTLVGAVLGVGMARGIGSLNLRVISTIFTSWIVTLPAGALLSILFFYFFKGLF
GA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggagtggatgctcgaacacagcaccctgatgctgctcattgccggcggcgccggtttc
ctgatggccctgggcgtgggcgccaatgacgttgccaacgccatgggcacgtcggtgggg
gcgcgggccctcaccgtcaaacaggcggttctgatcgccatcgttttcgagttcgccggg
gcctacctggccggcggcgaagtcaccgccaccatccgcaagggcatcatcgacgccgag
gtgttcaaccagacgcctcattatctggtctacggcatgctcgccgcgttactggccgcc
ggtatctggctggtggtggcctcctgggcgggctggccggtatcgaccacccactccatc
gtcggcgccatcgtcggcttcgcggcggttggcgtgggcatggactcggtgcattggggg
caggtgggttccatcgtcgccagttgggtcacctcgccgctgctggcgggcttcctctcc
ttcgccttgataaagagcgtgcagaaactggttctcaaccatgacgacccgttccagcgg
gccaagaaagtggtgccgttctacatgttcctggtgggtttcgtgatcaccaaggtaacc
ctggtcaaaggcctcaagcacgtggggctggagatgagctttggcgccagcaccctgtgg
gccatcgccggcggcgccgtggtggccggcctcggggttctgttcctgagccgtatccag
ccagatccggaagccgacaaggattttcgtttcagttcggtggagcgggtgttcgcggta
ctgatgattttcaccgcttgcgccatggccttcgcgcatggctccaatgacgtggccaat
gcggtgggcccgctggcggcgatcagcagcgtgctcgccaatggcggcgtgattggcaag
gaagcgattattcccagttgggttttactggtaggggccatggggatcgtctttggcctg
gcggtactcggcgcccgggtgatggccacggtgggcaccaagatcaccgagctgaccccg
agccgcggcttcgccgccgaactgggcgccgccaccaccgtggtgctggcgtccggcacc
ggcctgcccatctccaccacccacactctggtgggcgcggtactcggcgtcggcatggcg
cgcggcattggctcgctcaacctgcgcgtgatcagcaccatcttcacctcctggatcgtc
accctgcccgccggggcgctgttgtcgattctgttcttctatttcttcaagggcctgttc
ggggcctga

DBGET integrated database retrieval system