KEGG   Alcanivorax xenomutans: P40_05690Help
Entry
P40_05690         CDS       T04770                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00230  Purine metabolism
axe00240  Pyrimidine metabolism
axe01100  Metabolic pathways
axe01110  Biosynthesis of secondary metabolites
axe01130  Biosynthesis of antibiotics
Module
axe_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
axe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
axe_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
axe_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P40_05690
   00240 Pyrimidine metabolism
    P40_05690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:axe04131]
    P40_05690
Enzymes [BR:axe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     P40_05690
Membrane trafficking [BR:axe04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    P40_05690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ARB44981
Position
1218894..1219325
Genome map
AA seq 143 aa AA seqDB search
MSVERTLSIIKPDAVAKNVIGEIVGRFEKAGLKVVAMKMLHLSREQAEGFYAEHKERPFF
GDLVAFMTSGPVIVQVLEGEGAVLKNRDLMGATNPKEAEAGTIRADFAETIDENAVHGSD
STESAAREVSYFFSDEEICPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagagcgtactctctcgatcatcaagcccgacgccgtggccaaaaacgtcatc
ggtgagatcgttggccgtttcgaaaaagcgggcctgaaggtcgtggccatgaaaatgctg
cacctgagccgtgagcaggccgagggcttctacgccgagcacaaggagcgtcctttcttc
ggtgatctggtggctttcatgaccagcggcccggtcatcgtgcaggtgctggaaggcgaa
ggcgcggtactcaagaaccgtgacctgatgggcgccaccaacccgaaagaagcggaagcc
ggcaccattcgcgccgacttcgccgaaaccattgacgaaaacgcggtacacggctccgac
tccactgagtccgccgcccgtgaagtgagctatttcttctccgacgaagaaatctgcccg
cgcacccgctaa

DBGET integrated database retrieval system