KEGG   Alcanivorax xenomutans: P40_07985Help
Entry
P40_07985         CDS       T04770                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00071  Fatty acid degradation
axe00072  Synthesis and degradation of ketone bodies
axe00280  Valine, leucine and isoleucine degradation
axe00310  Lysine degradation
axe00362  Benzoate degradation
axe00380  Tryptophan metabolism
axe00620  Pyruvate metabolism
axe00630  Glyoxylate and dicarboxylate metabolism
axe00640  Propanoate metabolism
axe00650  Butanoate metabolism
axe00900  Terpenoid backbone biosynthesis
axe01100  Metabolic pathways
axe01110  Biosynthesis of secondary metabolites
axe01120  Microbial metabolism in diverse environments
axe01130  Biosynthesis of antibiotics
axe01200  Carbon metabolism
axe01212  Fatty acid metabolism
axe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P40_07985
   00630 Glyoxylate and dicarboxylate metabolism
    P40_07985
   00640 Propanoate metabolism
    P40_07985
   00650 Butanoate metabolism
    P40_07985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    P40_07985
   00072 Synthesis and degradation of ketone bodies
    P40_07985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P40_07985
   00310 Lysine degradation
    P40_07985
   00380 Tryptophan metabolism
    P40_07985
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P40_07985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P40_07985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P40_07985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axe04147]
    P40_07985
Enzymes [BR:axe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     P40_07985
Exosome [BR:axe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P40_07985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ARB45378
UniProt: A0A1V0FIY2
Position
1703332..1704540
Genome map
AA seq 402 aa AA seqDB search
MLDAYIYDGLRTPFGRHAGALAPVRPDDLLASVISTLVNRNDFPLEKFEDVVAGNTNQAG
EDARNVARHAGLLAGLPESVAGVTVNRLCGSGLAATLDAARMVTANEGDLVIAAGVESMS
RAPFVMAKAQTAYSRDMKVFDSTIGARFPNPRILKEFGADTMPETAHNVAAELGISREEA
DAYAAQSQARYEAARADGFFKEEIMPVEVPQGRKKPPLVVDADEHPRPGTGAEQLAKLPA
IVEGGIVTAGNASGVNDGAAALIIGSRAAGEAAGIAPRARIIAGGVAGVAPRVMGLGPVE
ACKKVLDRAGLTLKDMDVIEINEAFATQVLGCCKQLGLKGDDERLNPNGGAIAVGHPLGA
SGSRLALTALRQLERTGGRYALVSLCIGIGQGVAMLIERLPR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgcctatatctacgacggtttgcgcactccttttggccgccacgccggcgcc
ctggcaccggtgcgtccggatgacctgctggcttccgtcatcagcaccctggtcaaccgc
aatgacttcccgctggagaagttcgaggacgtggttgccggtaacaccaaccaggccggc
gaagatgcccgtaacgtggcccgtcacgccggtttgctggccggcctgccggagtcggtg
gccggtgtcaccgtgaaccgcctgtgcggttccggtctggccgccactctggacgccgcc
cgcatggttaccgctaatgaaggcgacctggtgatcgccgccggcgtggaatccatgagc
cgcgccccgttcgtcatggccaaagcacaaaccgcttatagccgtgacatgaaggtgttc
gacagcaccatcggcgcgcgcttccccaacccgcgtattctgaaggaattcggcgccgac
accatgccggaaaccgctcacaacgtggccgccgaactgggcatcagccgcgaggaagcg
gacgcctacgcggcccagtcccaggctcgctatgaagccgcccgcgccgacggtttcttc
aaggaagagatcatgccggtggaagtgccccagggccgcaagaagccgccgctggtggtg
gatgccgacgagcacccgcgcccgggcaccggcgccgagcaactggccaagctgccggcc
atcgttgagggcggcatcgtcaccgccggcaacgcctccggggtcaacgacggcgccgcc
gcgctgatcatcggctcccgcgccgccggcgaagccgccggtatcgcgccgcgtgcccgc
atcatcgccggcggcgtggccggtgtcgcaccgcgggtcatgggcctgggcccggtggag
gcctgcaagaaggtactggaccgtgccggtctgactctcaaggacatggacgtaattgaa
atcaacgaggccttcgccactcaggtgctcggctgctgcaagcaactgggcctgaaaggc
gacgacgagcgcctcaacccgaacggtggcgccatcgccgtcggccacccgctgggcgct
tccggttcccgtctggctctgaccgcgctgcgtcagctggaacgtaccggcggccgctac
gcgttggtgagcctgtgtatcggtatcggccagggcgtggccatgctgatcgagcgcctg
ccgcgctaa

DBGET integrated database retrieval system