KEGG   Alcanivorax xenomutans: P40_11335Help
Entry
P40_11335         CDS       T04770                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00640  Propanoate metabolism
axe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    P40_11335
Enzymes [BR:axe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     P40_11335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ARB45929
Position
complement(2456891..2459497)
Genome map
AA seq 868 aa AA seqDB search
MNTDYRKPLPGTDLDYFDTRAAVDAIQPGAYDKLPYTSRILAEQLVRRCAPESLTDSLKQ
LIERQRTLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPSKVNPVVPTQLIVDH
SLAVEHPGFEKDAFEKNREVEERRNADRFHFINWTKTAFDNVDVIPPGNGIMHQINLEKM
SPVVQVGSDGSGRSVAYPDTCVGTDSHTPMVDALGVISVGVGGLEAENVMLGNPSMMRLP
DIVGVELTGKLKPGITGTDLVLALTEFLRRERVVGAYLEFYGEGADSLSVGDRATIANMT
PEYGATAGMFFIDDQTIEYLKLTGREDEQVALVETFAKETGLWADSLKTAEYERVLKFDL
SQVERNLAGPSNPHALLPVSQLHDRGIAREWEEEEGLMPDGAVIIAAITSCTNTSNPRNI
IGAGLLARNANKLGLVRKPWVKSSLAPGSKTVKMYLEESGLLPELQNLGFDVVAFACTTC
NGMSGALDPKIQKEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTI
RFDIEKDALGKDQDGNPIYLKDIWPSDEEIDAIVKSAVKPEQFRKTYIPMFEKKGDGARA
ASPLYDWRPQSTYIRRPPYWEGNMAGQRQMKGMRPLAILPDNITTDHLSPSNAILLDSAA
GAYLHKMGLPEEDFNSYATHRGDHLTAQRATLANPKLFNEMCRDDSGNVIQGSLARVEPE
GQQMRMWEAIETYMERKQPLIIIAGADYGQGSSRDWAAKGVALAGVEVIAAEGFERIHRT
NLIGMGVMPLQFEEGTTRNTLKLDGTEIYDVEGELAPRATLTLVITRNNGDVDRVPMICR
LDTAEEVSVYTSGGILQKFAKEFMAEAG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgactaccgcaaaccgttgcccggtaccgatctcgactacttcgacacccgt
gccgcggtcgacgccatccagcccggcgcttacgacaagctgccctacacctcccgcatc
ctggccgagcagctggttcgccgctgtgcaccggaatcgctcaccgattccctgaagcag
ttgatcgaacgccagcgcaccctggactttccctggtacccggctcgtgtggtgtgccac
gacattctcggccagaccgcactggtggacctggccggtctgcgtgacgccatcgccgaa
aaaggcggggacccgtccaaggtgaacccggtggtgccgacccagctgatcgtggatcac
tccctggcggtcgaacatccggggttcgagaaagacgcgttcgagaaaaaccgggaggtg
gaagagcgccgtaacgcggatcgtttccacttcatcaactggaccaagaccgcgttcgat
aacgtggatgtgattccgccgggtaacggcatcatgcaccagatcaatctggagaaaatg
tccccggtggtgcaggtcggttctgatggcagcggacggagcgtggcttatccggatacc
tgcgtgggtaccgacagtcacacgccgatggtcgacgccctgggcgtgatctccgtgggt
gtgggcggtctggaagccgaaaacgtgatgctgggcaatccgtccatgatgcgcctgcct
gatattgtcggcgtggaactgaccggcaagttgaagccgggcatcaccggtactgacctg
gtactggcattgaccgaattcctgcgccgcgagcgggtggtcggcgcctatctggaattc
tatggtgaaggcgctgacagcctgtccgtgggcgaccgcgccaccatcgccaatatgaca
ccggaatacggcgccaccgccggtatgttcttcatcgacgatcagaccatcgagtatctg
aagctgactggccgcgaagacgagcaggtggctctggtggaaacgttcgccaaggaaacc
ggactgtgggcggacagcctgaagaccgccgaatacgaacgcgttctgaagttcgatttg
tcccaggttgagcgtaacctggccggcccgtccaatccgcatgcactgctgccggtgtct
cagttgcacgatcgcggcatcgccagggaatgggaagaggaagaagggctgatgcccgat
ggcgcggtgattatcgcggccatcaccagctgcaccaatacgtccaatccgcgcaacatc
atcggcgccggtctgctggcccgcaacgccaacaagctgggcctggtacgcaagccgtgg
gtgaagagctccctggcgccgggctccaaaacggtgaagatgtaccttgaggaatccggt
ttgctgccggaactgcagaacctgggcttcgacgtggtggcgttcgcctgcaccacctgt
aacggcatgtccggagctctggatcccaagatccagaaagaggtcatcgaccgcgatctg
tatgccaccgcggtgctttccggtaaccgcaacttcgacggccgtatccacccttacgcc
aagcaggcgttcctggcttcgccgccgctggtggtggcctatgccatcgccggcaccatc
cgtttcgacatcgaaaaggacgcgctgggcaaggatcaggacggcaacccgatttatctg
aaggacatctggccttccgatgaagagatcgatgccattgtgaagtcggcggtgaaaccc
gagcagttccgcaagacctacatcccgatgttcgagaagaaaggcgacggcgcccgtgcc
gccagcccgttgtacgactggcgtccacaatccacctacatccgccgccctccctattgg
gaaggcaacatggcggggcagcgtcagatgaagggtatgcgtccgctggcgatcctgccg
gacaacatcaccaccgatcacctgtcgccctccaacgccatcctgctggacagcgccgcc
ggtgcctacctgcacaagatgggcctgccggaagaggacttcaactcgtacgcgacgcac
cgtggcgatcacctgaccgctcagcgtgccactcttgcgaacccgaaactgttcaacgag
atgtgccgtgacgacagcggtaacgtgatccagggctcgctggcacgggtggaaccggaa
ggccagcagatgcgcatgtgggaagccatcgaaacctacatggagcgcaagcagccgctg
atcatcatcgccggcgcggattacgggcagggctcgtcccgtgactgggccgccaaaggc
gtggcgctggccggtgtggaagtgatcgccgccgaaggtttcgaacggattcaccgtacc
aatctgatcggtatgggcgtgatgccgctgcagttcgaggaaggcaccactcgcaacaca
ctcaagctcgacggcaccgaaatctatgacgtggaaggtgagctggcaccgcgtgcgacc
ctgacgctggtgattacccgcaacaacggtgacgtggatcgcgtgccgatgatctgccgg
ttggatacggcggaggaggtatcggtatacaccagcggcggcatcctgcagaaattcgcc
aaggagttcatggcggaagcgggctga

DBGET integrated database retrieval system