KEGG   Alcanivorax xenomutans: P40_18230Help
Entry
P40_18230         CDS       T04770                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
axe  Alcanivorax xenomutans
Pathway
axe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:axe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    P40_18230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:axe03011]
    P40_18230
Ribosome [BR:axe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    P40_18230
  Bacteria
    P40_18230
  Archaea
    P40_18230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 RuvA_C Spatacsin_C
Motif
Other DBs
NCBI-ProteinID: ARB47112
Position
complement(3969321..3969665)
Genome map
AA seq 114 aa AA seqDB search
MATEVAARLRGARISAQKARLVADQIRGLEVEKALNVLAFSPKKAAKIVKKVLESAIANA
ENNDGADVDELKVSTIYVDEGMSMKRIRPRAKGRADRILKRTCHITVKVSEGQE
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaagttgcagcccgtctgcggggcgcaagaatttcggctcagaaagcccgc
ctggtggccgaccagatccgaggtctggaggtggaaaaggcgttgaatgttctcgccttt
agccccaagaaggcggccaagattgttaagaaggtgctggagtccgcgattgctaacgcg
gaaaacaacgacggcgccgatgtggatgagctgaaagtatccaccatctacgtggatgaa
ggcatgtcgatgaagcgtattcgtcctcgcgcgaaagggcgggcggatcgcattctcaag
cgtacctgccacatcactgtaaaagtctcggaaggtcaggagtaa

DBGET integrated database retrieval system