KEGG   Amphibacillus xylanus: AXY_04200Help
Entry
AXY_04200         CDS       T02266                                 

Definition
(GenBank) putative 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
axl  Amphibacillus xylanus
Pathway
axl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:axl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AXY_04200
Enzymes [BR:axl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AXY_04200
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AXY_04200
    1.1.1.-  
     AXY_04200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_2 Pyr_redox_3 FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: BAM46552
UniProt: K0J027
Position
426713..427771
Genome map
AA seq 352 aa AA seqDB search
MKAAIIYGAKDVRVEDVAVKAVGENDVKIEVAWAGICGSDLHAYSQPEGLLPTNEVHPLS
NRKMPLTLGHEFSGTITEVGSNVTDLKVGDRVCVEPNLRCEKCKECREGNYHICRNSGAA
FIGLSDDGGFAEYCVLDQKHVYRIPENMTLEQAALVEPTAVTHRGVEVGGVKSGDKVLIT
GAGPIGLLTALCARAAGATSVYITDVSKERLALADSFGFATTLNPTEVDVVERIMKDTNN
TGVDVAIECAGVQATFDTCMQAVKITGTVCLVAIFAEDPKLPTFQALVKEAKVVSSLAYA
HNYDKVIDLIASGQVPAEKIITNKINLDNIVEDGFELLLNDKSQSKILVSAK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctattatttacggagcaaaagatgttcgagttgaagatgtagcggttaaa
gcagtaggtgaaaatgatgtaaaaattgaagtagcttgggctggtatttgtggttctgat
ttacatgcttattcacaaccagagggtctattaccaacaaatgaagttcacccattatca
aaccgaaaaatgcctttaacattaggtcatgaattcagtgggacgattactgaagtagga
agtaatgtcacagaccttaaggttggcgatcgtgtttgtgtagagccaaacctacgctgt
gaaaaatgtaaagagtgtcgtgaaggaaattaccatatttgccgcaatagcggtgctgcc
tttattggtttatctgatgatggtggttttgcagaatattgtgtattagatcaaaaacat
gtttatcgaattcctgaaaatatgacacttgagcaagcagcacttgttgagccaactgca
gttacacatagaggtgttgaagtaggtggagttaaatcaggtgataaagtattaattaca
ggtgcaggcccaattggactattaacagcattatgtgcacgtgcagctggtgcgacttct
gtttatattactgatgtttctaaagagcgtttagcactagcagatagtttcggatttgca
acaacattaaatccgacagaagtagacgttgtagaacgaattatgaaagatacaaataac
actggtgtagacgtagcaattgagtgtgcgggtgtacaagctacatttgatacatgtatg
caagcggtaaaaatcactggaacagtttgtctagtggcaatctttgctgaagatccaaaa
ttacctacattccaagcgctcgttaaggaagcaaaagttgtatcaagcttagcgtatgca
cacaactacgataaggtaattgatttaattgcaagcggacaagttccagcagaaaaaatt
attacaaataagatcaatttagataatattgttgaagatggatttgaattattactaaat
gacaagagccaatctaagattctagtcagcgcaaaataa

DBGET integrated database retrieval system