KEGG   Amphibacillus xylanus: AXY_09300Help
Entry
AXY_09300         CDS       T02266                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
axl  Amphibacillus xylanus
Pathway
axl00010  Glycolysis / Gluconeogenesis
axl00030  Pentose phosphate pathway
axl00051  Fructose and mannose metabolism
axl00052  Galactose metabolism
axl00680  Methane metabolism
axl01100  Metabolic pathways
axl01110  Biosynthesis of secondary metabolites
axl01120  Microbial metabolism in diverse environments
axl01130  Biosynthesis of antibiotics
axl01200  Carbon metabolism
axl01230  Biosynthesis of amino acids
axl03018  RNA degradation
Module
axl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_09300 (pfkA)
   00030 Pentose phosphate pathway
    AXY_09300 (pfkA)
   00051 Fructose and mannose metabolism
    AXY_09300 (pfkA)
   00052 Galactose metabolism
    AXY_09300 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AXY_09300 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AXY_09300 (pfkA)
Enzymes [BR:axl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AXY_09300 (pfkA)
Protein phosphatases and associated proteins [BR:axl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AXY_09300 (pfkA)
Messenger RNA biogenesis [BR:axl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AXY_09300 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 DAGK_cat NAD_kinase DUF4347 AhpC-TSA_2
Motif
Other DBs
NCBI-ProteinID: BAM47062
UniProt: K0J1S2
Position
981210..982169
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRKGIYHGIEIYGVSNGFQGLMEGKIKKMELGSVGDI
IQRGGTILFSARSEEFKTDEGQERAIKQLRDRGIEGLVVLGGDGSFTGALKLTEKGFPCV
CIPCTIDNDIPGTDFTIGFDTALNTIVEAADKIRDTATSHERTYVIEVMGRDAGDLALWS
GLANGAESVIIPERDEPFENIIDRLNRGRARGKKHSIIILAEGVGSGIELGKRIEETANL
ETRVTVLGHIQRGGQPTGADRVLASRLGAKAIDLLIEGQSGVMVGIESNKLTHHKIKDIL
NKPHNIDMSLYKLMGELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagctgttttgacaagcggtggagatgctccaggtatgaacgcagctatt
cgagcggtagtcagaaaaggtatctatcatggtattgaaatatacggtgtatcaaacggt
tttcaaggcttgatggaaggtaagatcaaaaaaatggaactcggctctgttggagatatc
attcaacgcggaggtacgattctgttttctgcgcgctctgaggaatttaaaaccgatgaa
ggtcaagaacgtgccattaaacaattgagagatagaggtattgaaggtttagtagttctt
ggcggtgacggttcatttacaggtgcgttaaaattgactgagaaaggctttccatgtgtc
tgcattccttgtacaattgataatgatattccaggaactgattttacaatcggttttgat
acagcattaaacactattgtagaagctgccgataaaataagagatacagcaacttctcat
gaacgtacatatgttatcgaggttatgggccgagatgcgggagatttagcactttggtca
ggtttagctaatggtgcagaaagcgtaatcattccagaacgcgacgaaccttttgaaaac
atcattgatcgtctaaatagaggacgagcacgtgggaaaaagcatagtattatcatttta
gctgaaggtgtcggtagtgggattgaactaggcaagagaattgaagaaacagctaatcta
gaaacacgcgtaaccgtattaggacacatccaacgtggtggacaaccaactggtgcagat
cgtgtattagcaagtcgtttaggcgctaaggcaatcgatttgttaattgaaggtcaatca
ggtgtgatggttggtattgagtcaaataaacttactcatcataaaatcaaggatatcctt
aataagccacacaacatagatatgagcttgtacaaacttatgggagaactatctatctaa

DBGET integrated database retrieval system