KEGG   Amphibacillus xylanus: AXY_13160Help
Entry
AXY_13160         CDS       T02266                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axl  Amphibacillus xylanus
Pathway
axl00071  Fatty acid degradation
axl00072  Synthesis and degradation of ketone bodies
axl00280  Valine, leucine and isoleucine degradation
axl00310  Lysine degradation
axl00362  Benzoate degradation
axl00380  Tryptophan metabolism
axl00620  Pyruvate metabolism
axl00630  Glyoxylate and dicarboxylate metabolism
axl00640  Propanoate metabolism
axl00650  Butanoate metabolism
axl00900  Terpenoid backbone biosynthesis
axl01100  Metabolic pathways
axl01110  Biosynthesis of secondary metabolites
axl01120  Microbial metabolism in diverse environments
axl01130  Biosynthesis of antibiotics
axl01200  Carbon metabolism
axl01212  Fatty acid metabolism
axl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXY_13160
   00630 Glyoxylate and dicarboxylate metabolism
    AXY_13160
   00640 Propanoate metabolism
    AXY_13160
   00650 Butanoate metabolism
    AXY_13160
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXY_13160
   00072 Synthesis and degradation of ketone bodies
    AXY_13160
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXY_13160
   00310 Lysine degradation
    AXY_13160
   00380 Tryptophan metabolism
    AXY_13160
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXY_13160
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXY_13160
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXY_13160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axl04147]
    AXY_13160
Enzymes [BR:axl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXY_13160
Exosome [BR:axl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXY_13160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAM47448
UniProt: K0J7I5
Position
1353675..1354853
Genome map
AA seq 392 aa AA seqDB search
MEEIVIVSAVRTPIGKFGGALKDISARQLGAIVVKEAIKRAKLDPSDIDQGIFGQVLQAG
SGQNVARQILVDADVPYSKPAMTINEVCGSGLKAIILGSQQIQLNQAEIVVVGGVESMSN
APHILPNYRFTKELEQKNLIDSMIHDGLTDAFSHMHMGITAENVAKKYNVTREEQDQFAL
NSQHKAQRAQETGKFKDEIVPVPVISETGDEVLFDQDEHIRKDVKIEDLAKLRTPFLEGG
TVTAGNASGINDGAAALILMKKSTAEKRGLNYFATIKDYAEIGMDPSLMGYSPYLSINKL
VEKAQIDLNQVDLFEINEAFAAQSIPVVRDLGIDPNKVNVNGGGIALGHPIGASGARIVV
TLLHEMNKTDGKLGIASLCVGGGIGVSMLVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatcgtaatagttagtgctgtacgtacaccaattggaaaattcggtggtgct
ttaaaagatatttctgcgcgacaattaggtgcaattgtagttaaagaagcaattaagcgc
gctaaattagatccatctgatattgaccaaggaatttttggacaagtgttacaagctgga
tcaggtcaaaatgtggctcgtcaaatattagtagatgcagatgttccttactcaaagcct
gcgatgaccatcaatgaagtttgtggctctggattaaaagctatcattctaggtagtcaa
caaattcaacttaaccaagcagaaatagttgtcgttggtggtgttgaaagtatgagcaat
gcccctcatatcctaccaaattaccgctttaccaaagagctagaacaaaaaaatctgatt
gattcaatgattcatgatggtttgacagacgcatttagtcacatgcatatgggtattact
gcggaaaatgtagcaaagaaatataatgttactagagaagaacaagatcaatttgcacta
aattctcaacataaagctcaacgtgctcaagaaacaggtaagtttaaagacgagattgtc
cctgttcctgttatatctgagactggagatgaggtactatttgatcaagacgaacatatt
agaaaagatgttaaaatagaagatttagctaaacttagaactccttttcttgaaggtggt
actgtaactgctggtaatgcttctggaattaacgatggtgcagcagcattaatcttaatg
aaaaaatcaacagccgagaaacgaggactaaactattttgcaacaattaaggattacgct
gagattggtatggatccaagcttaatgggctatagcccttatctatcaattaacaaactc
gttgaaaaagctcaaatcgatcttaatcaagttgatttatttgaaattaacgaagccttt
gcagcacaaagtattccagttgttcgcgatttagggattgaccctaacaaagtcaatgta
aatggtggcggaatcgctcttggtcaccctatcggtgcttccggagcaagaatcgtcgtg
acactccttcacgaaatgaataagacggatggaaaattaggaatcgctagtctttgtgtc
ggtggcggaattggtgtatctatgcttgttgaacgataa

DBGET integrated database retrieval system