KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_0372Help
Entry
AX27061_0372      CDS       T02964                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Brite
KEGG Orthology (KO) [BR:axn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AX27061_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHC44840
Position
394318..394692
Genome map
AA seq 124 aa AA seqDB search
MKPYDLSVSVTPRFVPEQSDPGEQQYVFAYTVRITNTGEHPAQVISRHWIITDGNQRVQE
VRGLGVVGQQPLLAPGETFEYTSGCPLPTPVGTMRGTYHCVGENGIPFEVPISEFVLAMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccctacgacctgagcgtctctgtcactccgcgcttcgtgcctgaacagtccgat
cccggcgaacagcaatacgtgttcgcctataccgtgcgcatcaccaataccggggagcat
ccggcccaggtgatcagccgccactggattatcaccgatggcaaccagcgcgtgcaggaa
gtgcgcgggctgggcgtcgtgggccagcagcccctgctggcgcccggcgagaccttcgaa
tacaccagcggctgccccctgcccacgccggtcggcacgatgcgcggcacctatcattgc
gtcggcgagaacggcattccgttcgaagtgccgatttccgaattcgtcctggccatgccg
cgcaccctgcactga

DBGET integrated database retrieval system