KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_0947Help
Entry
AX27061_0947      CDS       T02964                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00010  Glycolysis / Gluconeogenesis
axn00071  Fatty acid degradation
axn00350  Tyrosine metabolism
axn00625  Chloroalkane and chloroalkene degradation
axn00626  Naphthalene degradation
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn01120  Microbial metabolism in diverse environments
axn01130  Biosynthesis of antibiotics
axn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AX27061_0947
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AX27061_0947
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AX27061_0947
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AX27061_0947
   00626 Naphthalene degradation
    AX27061_0947
Enzymes [BR:axn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AX27061_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AHC45413
Position
complement(1008808..1009722)
Genome map
AA seq 304 aa AA seqDB search
MAEKVRTFGADSLIAIGGGSVADSAKALALLLAEGGRLADHVTTFEPPATARIPRRVRPQ
LPIIGIPTTASGAETTSSFGVRRQDGHKLMFWNRGVAAATLLIDPRLSAGQPVALLRDSA
MNGIAHALEALYSRGRSPVSDCIAVQAIRLFDSALDGDSLAAGDARGAILQAAHLAGLAL
SMARSCLHHAICHVVASRQRLSHGAVNSVILPHALAFNEAAAADALRPALDAINQRARRP
HVTLSAWVRDIQRRHAMPARLSELGVAREALGAMARDVLTERGLALNPRPVSEAEASGIL
RAAF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaagtgcggacattcggcgcggacagcctgatcgccatcggcggcggcagc
gtggccgacagcgccaaggccctggcgctgctcctggccgaaggcggccggctggccgac
cacgtcaccaccttcgaaccgcccgccacggcgcgcattccgcgccgtgtccggccgcag
ctgccgatcatcggcatccccacgaccgcctcgggcgcggaaaccacgtcgtcgttcggc
gtgcgccggcaagacggccacaagctgatgttctggaaccgcggggtggccgcggcgacc
ctgctgatcgatccgcgcctgagcgcgggccaacccgtcgcgctgctgcgcgacagtgcc
atgaacggcatcgcccacgcactggaggccctgtattcgcggggacgatcgcccgtgtcc
gattgcatcgccgtgcaggcgatccggctgttcgacagcgccctcgacggcgacagcctc
gccgctggcgacgcgcgcggcgcgatcctgcaagcggcgcatctggccgggctggccctg
tcgatggcgcgcagctgcctgcatcacgccatctgccatgtcgtggcgtcgcgccagcgg
ttgtcgcacggcgcggtcaacagcgtgatcctgccgcatgcgctggcgttcaacgaagcg
gcagcggccgacgcgctgcggccggcgctcgacgcaatcaaccagcgggcgcgccggccg
cacgtcacgctgtcggcctgggtgcgggacatccagcggcgccacgccatgcccgcgcgg
ctgtcggaacttggcgtggcacgcgaggcgctcggcgccatggcccgcgacgtcctgacc
gaacgagggctggcgctcaatccccggccggtatccgaagccgaggcctcaggaattctg
cgggccgctttctag

DBGET integrated database retrieval system