KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_1420Help
Entry
AX27061_1420      CDS       T02964                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00562  Inositol phosphate metabolism
axn00564  Glycerophospholipid metabolism
axn00565  Ether lipid metabolism
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AX27061_1420
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AX27061_1420
   00565 Ether lipid metabolism
    AX27061_1420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AX27061_1420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:axn02042]
    AX27061_1420
Enzymes [BR:axn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     AX27061_1420
Bacterial toxins [BR:axn02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   AX27061_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AHC45885
Position
complement(1552809..1554959)
Genome map
AA seq 716 aa AA seqDB search
MQSRREFLRGGAAIAGAGSALALLPASIRRALAIPANRRKGTIEDVEHIVIFMQENRSFD
HYFGGLAGVRGFGDRFPIPVPASPDFERRTVWGQYNGRPDAGAPRSVLPFRLDTGAAYEA
MRVASTPHTWSNAQDAWDAGRMGQWPAAKKNHSMAYYTEADMPFQYAMARAFTVCDAYHC
SFTGGTNTNRLFLWSGTNDGLGRGHGPALGNTYNKLGGGDPAGAYTWTTYPERLERAGIR
WRIYQDMADNYSLNPTAGFKAYRDAYHGVPGSLAALKDKALTTRGLDLLRQDVLDGTLPQ
VSWICATKAGSEHPSPSSPAQGADYTARVLDALTANPEVWSKTVLLLMFDENDGFFDHMP
PPAPPSRGPDGRLAGASTVDTAGEYHEIVTGAEKDDTAAHLHGVYGLGPRVPMYVLSPWT
KGGWVNSEVFDHTSVLRFVERRFGVAEPNISPWRRAVCGDLTSIFDFATPDGANLTRGLP
ATATRAARAAALPGTITPPAPERPALARQAAGTRPSRPLPYALSARDRVADERIMLRFDN
TGSAGAVLHVYDRQRLEDGPRRYTVEAGKHLEDGWQVTGDDGRYDLWILGPNGFHRHLAG
RLRADPAPLAVEAACDAAGPTLRLKIHNPGGLARGFQVEANAYGHAGHHEPALAPGLGAT
LAWDLAASGGWYDFSVRADDAPGFIRRFAGRVETGAPSISDPAMGEELILQWTPPA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcccgacgcgaattcctgcgcggcggcgccgcgatcgccggcgccggcagcgcc
ctggcgctgctgcccgcctccatccgccgcgcgctggcgattcccgccaaccgccgcaag
ggcaccatcgaggacgtcgagcacatcgtcatcttcatgcaggaaaaccgttcgttcgac
cattacttcggcggcctcgccggggtgcgcggcttcggcgaccgctttcccatcccggtg
cccgccagtcccgacttcgaacgccgcacggtctgggggcagtacaacggccgtcccgat
gccggcgcgccgcgcagcgtgctgccgttccggctcgacaccggcgcggcctacgaagcc
atgcgcgtggccagcacgccgcacacctggtccaacgcccaggacgcctgggacgccggc
cgcatgggccaatggccggccgccaagaagaaccattcgatggcgtactacaccgaggcc
gacatgccgttccagtacgccatggcgcgcgccttcaccgtgtgcgacgcctaccactgc
tcgttcaccggcggcaccaatacgaatcggctgttcctctggagcggcaccaacgacggc
ctggggcgcggccacgggccggcgctgggcaacacctacaacaagctgggcggcggcgat
ccggccggcgcctacacctggaccacctatcccgaacgcctggagcgcgccggcatccgc
tggcgcatctaccaggacatggcggacaactactcgctcaacccgaccgcgggcttcaag
gcctaccgcgacgcttaccacggcgtgccgggctcgctggccgcgctcaaggacaaggcg
ttgaccacccgcggcctggacctgctgcgccaggacgtgctcgatggcaccttgccgcag
gtgtcgtggatctgcgccaccaaggccggctccgagcatcccagcccctccagcccggcg
cagggcgcggactacacggcaagggtgctggacgcgctgaccgccaatcccgaggtctgg
agcaagaccgtcctcttgctgatgttcgacgagaacgacggcttcttcgaccacatgccg
ccgcccgccccgccctcgcgcggcccggacggccggctggcgggcgcgtccaccgtggac
accgccggcgaataccacgagatcgtcaccggcgccgaaaaggacgatacggccgcccac
ctgcacggcgtctacggcctggggccgcgcgtgccgatgtacgtgctgtcgccctggacc
aagggcggctgggtcaactccgaagtgttcgaccacacctcggtgctgcgcttcgtcgag
cgccgcttcggcgtcgccgaacccaacatctcgccgtggcgccgcgcggtctgcggcgac
ctgacgtcgatcttcgatttcgccacgcccgatggcgccaacctgacgcgcggcctgccg
gccaccgccacgcgcgcggcgcgggccgccgcgctgccgggcaccatcaccccgcccgcg
cccgaacggccggccctggcgcggcaggcggccggcacgcggccgtcgcggccgctgccg
tatgccttgtcggcgcgggaccgcgtggcggatgaacgcatcatgctgcgtttcgacaat
accggcagtgccggcgccgtgctgcacgtctacgaccgccagcggctggaagacggcccg
cgccgctacacggtcgaagccggcaagcacctggaggatggctggcaggtgacgggcgac
gacggccgctacgatctgtggatactgggcccgaacggctttcaccgccaccttgccggc
cggctgcgcgccgatcccgcgcccctggcggtcgaagccgcctgcgatgccgccggcccg
acgctgcggctgaagatccacaaccccggcgggctggcgcgcggcttccaggtcgaggcc
aacgcctatggccatgccggccaccacgagccggcgctggcgcccggcctgggcgccacc
ctggcctgggacctggccgccagcggcggctggtacgacttcagcgtgcgcgccgacgac
gcgcccggcttcatccgccgcttcgccggacgcgtcgagaccggcgcgccttccatctcc
gaccccgcgatgggcgaagaattgatcctgcaatggacgccacccgcatga

DBGET integrated database retrieval system