KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_1495Help
Entry
AX27061_1495      CDS       T02964                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00260  Glycine, serine and threonine metabolism
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn01120  Microbial metabolism in diverse environments
axn01130  Biosynthesis of antibiotics
axn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AX27061_1495
Enzymes [BR:axn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AX27061_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 BAT Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AHC45960
Position
1628638..1629648
Genome map
AA seq 336 aa AA seqDB search
MIDLRSDTVTRPSPAMLQAMVSAPLGDDVMGDDPTVIQLQQAVAERAGKAAGLFFPSGTQ
SNLAALMAHCERGDEYLVGQQAHTYKYEGGGAAVLGSIQPQPIEHAEDGTLPLEKLAAAL
KPEGDPHFARTRLLALENTFHGKLIPADYVRAATDWARAHGLATHLDGARVFNAAVASGK
PLAEMCAPFDSVSICFSKGLGAPVGSVLAGSAELIARARRWRKVLGGGLRQSGVLAAACL
YALEHNVERLAEDHANARLLAEGLRGIAGVRVLSQDTNMVFAEFEPARCDALTAALAADG
ILMRAVYGGPTRMVTHLDLSSDDVRRVIEAVARHLA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttgcgcagtgataccgtcacccggccgtccccggccatgttgcaggccatg
gtcagcgcgccgctgggcgatgacgtgatgggcgatgaccccaccgtcatccagctgcag
caagccgtggccgaacgcgcgggcaaggccgccgggctgttcttcccgtcgggcacgcag
agcaatctggcggcgctgatggcgcattgcgagcggggcgatgagtatcttgtgggccag
caggcgcatacctacaagtacgaaggcggcggcgcggcggtgctgggcagcatccagccc
caacccatcgaacacgccgaggacggtacgctaccgttggaaaagctggcggccgctctc
aagcccgaaggcgatccccactttgcccgcacccgcctgctggcgctggaaaacacgttc
cacggcaagctgattcccgccgactacgtgcgtgccgccaccgactgggcccgcgcccat
ggcctggccacgcacctggacggcgcgcgcgtgttcaacgcggcggtggccagcggcaag
ccgctggccgagatgtgcgcgccgttcgattcggtgtcgatctgcttttccaaggggctg
ggcgcgccggtcggctccgtgctggcgggcagcgccgaactgatcgcccgcgcccgccgc
tggcgcaaggtgctgggcggcggcctgcgccaatcgggggtgctggcggcagcctgcctg
tatgcgctggaacacaatgtcgagcgcctggccgaagaccacgccaacgcgcgcctgctg
gccgaaggactgcgcggcatcgccggcgtgcgggtgctgagccaggacaccaacatggtg
ttcgcggagttcgagccggcgcggtgcgatgccttgaccgccgcgctggcggccgacggc
atcctgatgcgcgccgtctatggcggcccgacgcgcatggtgacgcacctggacctgtcc
agcgacgacgtgcgccgggtgatcgaggccgtggcgcgccacctggcttga

DBGET integrated database retrieval system