KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_2310Help
Entry
AX27061_2310      CDS       T02964                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00071  Fatty acid degradation
axn00072  Synthesis and degradation of ketone bodies
axn00280  Valine, leucine and isoleucine degradation
axn00310  Lysine degradation
axn00362  Benzoate degradation
axn00380  Tryptophan metabolism
axn00620  Pyruvate metabolism
axn00630  Glyoxylate and dicarboxylate metabolism
axn00640  Propanoate metabolism
axn00650  Butanoate metabolism
axn00900  Terpenoid backbone biosynthesis
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn01120  Microbial metabolism in diverse environments
axn01130  Biosynthesis of antibiotics
axn01200  Carbon metabolism
axn01212  Fatty acid metabolism
axn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX27061_2310
   00630 Glyoxylate and dicarboxylate metabolism
    AX27061_2310
   00640 Propanoate metabolism
    AX27061_2310
   00650 Butanoate metabolism
    AX27061_2310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AX27061_2310
   00072 Synthesis and degradation of ketone bodies
    AX27061_2310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX27061_2310
   00310 Lysine degradation
    AX27061_2310
   00380 Tryptophan metabolism
    AX27061_2310
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AX27061_2310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AX27061_2310
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AX27061_2310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axn04147]
    AX27061_2310
Enzymes [BR:axn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AX27061_2310
Exosome [BR:axn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AX27061_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C HMG_CoA_synt_N
Motif
Other DBs
NCBI-ProteinID: AHC46773
Position
2536247..2537419
Genome map
AA seq 390 aa AA seqDB search
MSKRAVIVGWSHIPFGKLDDPDTESLMARVSGAALEHAGVSPQAVDGIYAGVMNSGFQKQ
DFQAALVALADPALAHVPATRLENACATGSAALYAAMDFIEAGRGRVALVVGAEKMTARS
TEDTGDILLNASYRKEEATLPGGFAGVFSRIATAYFERHGDHGEALARIAAKNHANALDN
PYAQIRKDLGFEFCNTVSEKNPYVAAPLRRTDCSPISDGAAALVLADAETAADLRRAIGF
RARRHVNDFLPLSRRDPIAFEGAARAWREALAEAGATLDDLSLVETHDCFTIAELIEYEA
MGLAPRGHGVRALREGWVQKGGRLPVNPSGGLKAKGHPVGATGVSQHVMACLQLAGEAGA
MQVPDATLAGVFNMGGAAVANYVSILERVK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgtgccgtcatcgtggggtggtcgcacatcccattcggcaaactcgacgac
cccgacaccgaaagcctgatggcgcgggtatccggcgccgcgctggagcacgcgggcgtg
agtccgcaggccgtggacggcatctatgccggcgtcatgaacagcggtttccagaagcag
gatttccaggccgcgctggtggccctggccgatccggcattggcccatgtgccggcaacc
aggctggagaacgcctgcgccacggggtcggccgcgctgtacgcggccatggatttcatc
gaggccgggcgcggccgcgtggcgctggtggtgggcgccgagaaaatgaccgcccgctcc
accgaggacaccggcgatatcctgctcaatgccagctaccgcaaggaagaagccacgctg
ccgggcggctttgccggcgtgttcagccgtatcgccacggcctatttcgagcgccatggc
gaccacggcgaggcgctggcccgcatcgccgccaagaaccacgccaacgcgctggacaat
ccctatgcgcagatccgcaaggacctgggcttcgagttctgcaataccgtttccgaaaaa
aatccctatgtggcggcgccgctgcggcgcaccgattgctcgcccatttccgacggcgcg
gcggcgctggtgctggccgacgcggaaacggcggcggacctgcgccgcgccatcggcttt
cgcgcgcggcgccacgtcaatgacttcctgccgctgagccggcgcgatcccatcgccttc
gagggcgcggcgcgggcctggcgcgaggccttggccgaggccggcgcgaccctggacgat
ttgagcctggtggagacgcacgactgcttcaccatcgccgaattgatcgagtacgaggcc
atgggcctggcgccgcgcggccatggcgtgcgggcattgcgcgaaggctgggtgcagaag
ggcgggcgcctgcccgtcaacccgtcgggcggactcaaggccaagggccatccggtgggc
gccaccggcgtgtcgcagcacgtcatggcgtgcctgcaactggccggcgaggcgggcgcc
atgcaggtgccggacgcgacgctggccggcgtcttcaacatgggcggcgcggccgtggcc
aactacgtcagcatcctggagcgcgtcaaatga

DBGET integrated database retrieval system