KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4572Help
Entry
AX27061_4572      CDS       T02964                                 

Definition
(GenBank) Aldehyde dehydrogenase B
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00010  Glycolysis / Gluconeogenesis
axn00053  Ascorbate and aldarate metabolism
axn00071  Fatty acid degradation
axn00280  Valine, leucine and isoleucine degradation
axn00310  Lysine degradation
axn00330  Arginine and proline metabolism
axn00340  Histidine metabolism
axn00380  Tryptophan metabolism
axn00410  beta-Alanine metabolism
axn00561  Glycerolipid metabolism
axn00620  Pyruvate metabolism
axn00625  Chloroalkane and chloroalkene degradation
axn00903  Limonene and pinene degradation
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AX27061_4572
   00053 Ascorbate and aldarate metabolism
    AX27061_4572
   00620 Pyruvate metabolism
    AX27061_4572
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AX27061_4572
   00561 Glycerolipid metabolism
    AX27061_4572
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX27061_4572
   00310 Lysine degradation
    AX27061_4572
   00330 Arginine and proline metabolism
    AX27061_4572
   00340 Histidine metabolism
    AX27061_4572
   00380 Tryptophan metabolism
    AX27061_4572
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AX27061_4572
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AX27061_4572
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AX27061_4572
Enzymes [BR:axn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AX27061_4572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh ETF
Motif
Other DBs
NCBI-ProteinID: AHC49030
Position
5056793..5058295
Genome map
AA seq 500 aa AA seqDB search
MDTPQDILRALGLNPATLTGGTLVARSPIDGAELAQVHEHTVAQAHAAITRARQASLAWR
DVPAPRRGELLRLFGEVLRQHKRELGRLVSLEAGKILAEGEGEVQEMIDICDFAVGLSRQ
LYGLTIASERPGHRMMETWHPLGVVGVISAFNFPVAVWSWNAALALVCGNAVVWKPSEKT
PLTALACQALFAQALQRFGDAPAGLSEVLIGGRDVGEALVDSHAVALVSATGSTRMGRQV
GPRVAQRFGRVLLELGGNNAIIVGPTADLDMAARGIVFGAIGTAGQRCTTTRRLIVHESV
ADDLLQRLHKAYASAPIGNPLDGKNLVGPLIDRASFDAMQAALKAAGEQGGKVTGGERVL
ADQYPDAWYVRPAIAEMPGQTDVVCHETFAPILYVMRYSDFNQALALQNGVPQGLSSAIF
TNDLREAETFLSAAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWRNYMRRA
TNTINYSRNLPLAQGIKFGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccccaagacatcctgcgcgcactcggcctcaaccccgcgaccctgaccgga
ggcacgctcgtcgcccgcagcccgatcgacggcgccgagctggcccaggtccatgaacat
acggtggcgcaggcccacgcggccatcactcgcgcccgccaggccagcctggcctggcgc
gacgtgccggcgccgcgccgcggcgaactgctgcgcctgttcggcgaagtgctgcgccag
cacaagcgcgaactgggccgcctggtcagcctggaagccggcaagatcctggccgagggc
gaaggcgaggtccaggaaatgatcgacatctgcgacttcgccgtgggcctgtcgcgccag
ttgtacggcctgaccatcgcttccgagcgccccggccaccgcatgatggaaacctggcat
ccgctgggcgtggtgggcgtcatcagcgccttcaacttcccggtggcggtgtggtcctgg
aacgcggcgctggcgctggtgtgcggcaacgccgtggtctggaagccgtcggaaaaaacg
ccgctgaccgcgctggcctgccaggcgctgttcgcgcaggctttgcagcgtttcggcgat
gcgccggccggcctgtcggaagtgctgatcggcggccgcgacgtcggcgaggcgctggtg
gattcgcacgccgtggcgctggtgtcggcgaccggctcgacccgcatgggccgccaggtc
ggcccgcgcgtggcgcagcgcttcggccgcgtgctgctggaactgggcggcaacaacgcc
atcatcgtcggccccaccgccgacctcgacatggcggcgcgcggcatcgtgttcggcgcc
atcggcaccgccggccagcgctgcaccaccacgcgccgcctgatcgtgcacgaaagcgtg
gccgacgatctgctgcaacgcttgcacaaggcctacgccagcgcgcccatcggcaacccg
ctggacggcaagaacctggtcggaccgctgatcgaccgcgcctcgttcgacgccatgcag
gccgcgctcaaggccgccggtgaacagggcggcaaggtcacgggtggcgaacgcgtgctg
gccgaccagtacccggacgcctggtacgtgcgccccgccatcgccgaaatgcccggccag
accgacgtggtctgccacgagaccttcgcgccgatcctgtacgtgatgcgctacagcgat
ttcaaccaggcgctggcgctgcagaacggcgtgccgcaaggcctgtcgtcggccatcttc
accaatgacctgcgcgaggccgagactttcctgtcggcggcgggctcggactgcggcatc
gccaacgtcaacatcggcacctcgggcgccgagatcggcggcgccttcggcggtgaaaag
gaaacgggcggcggccgcgaatcgggctcggacgcctggcgcaactacatgcgccgcgcc
accaacaccatcaactactcgcgcaacctgccgctggcgcagggcatcaagttcggcgag
taa

DBGET integrated database retrieval system