KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4589Help
Entry
AX27061_4589      CDS       T02964                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00780  Biotin metabolism
axn01100  Metabolic pathways
Module
axn_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AX27061_4589
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:axn01007]
    AX27061_4589
Enzymes [BR:axn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     AX27061_4589
Amino acid related enzymes [BR:axn01007]
 Aminotransferase (transaminase)
  Class II
   AX27061_4589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHC49046
Position
5073679..5074863
Genome map
AA seq 394 aa AA seqDB search
MSKLDPLFSSELAQAESRRVRRRLRTATAAPAGRIALDGVPALNFSSNDYLGLSKHPLLI
ERSREWAARHGAGAQASRLVCGNLDLHEQVEAKLARLKGTEAALLLASGWQANAAVLPAL
LRAAAGQGEVQVYADKLNHASLHHGCQAAGVRQIRFRHNDLDHLEALLAARAGPSAAPAA
RFIITESVFSMDGDRTDVARLAALAERYQAFVYLDEAHATGVLGPGGMGLAGLAPGGIDL
TMGTFSKALGGFGAYVAGSRALCDYLVNACSGFIYTTALPPAVLGAMDAALDLVPTLDAE
RARLAASGERLRVALRSLGLDSGDSSTQIVPAIVGDEGRALALAATLEQRGLLAVAIRPP
TVPAGTSRLRIALSAAHRDADIDRLIDGLTAALA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagctggatcccctcttttcttccgaactggcgcaagccgaatcgcgccgcgtg
cggcgccggctgcgcacggccaccgccgcgcccgccggccgcatcgcattggacggcgtc
ccggcgctgaacttctccagcaacgactacctgggcctgtccaagcacccgctgctgatc
gagcgctcgcgcgaatgggccgcccgccatggcgccggcgcgcaggcctcgcggctggtg
tgcggcaatctcgacctgcacgagcaggtcgaggccaagctggcgcgcctgaaaggcacc
gaggccgcgctgctgctggcctccggctggcaggccaatgccgccgtgctgccggccctg
ctgcgcgcggccgccggccagggcgaagtgcaggtctacgccgacaagctcaaccatgcc
agcctgcatcacggctgccaggcagccggcgtgcggcagatccgcttccgccacaacgac
ctggaccacctcgaagcgctgctggcggcgcgcgccgggccatcggccgcgcccgccgcg
cgcttcatcatcaccgaaagcgtcttcagcatggacggcgaccgcaccgacgtggcgcgg
ctggcggcgctggccgagcgctaccaggccttcgtctacctggacgaagcccacgccacc
ggcgtgctgggaccgggcggcatggggctggccgggctggcgccgggcggcatcgacctg
accatgggcaccttcagcaaggcgctgggcggcttcggcgcctacgtggccggctcgcgc
gcgctctgcgactacctggtcaacgcctgttcgggtttcatctacaccaccgccctgccg
cccgcggtgctgggcgccatggacgccgccctggacctggtgccgacgctggacgccgag
cgcgcccggctggcggcctcgggcgagcggctgcgcgtcgcgctgcgcagcctggggctg
gacagcggcgactcgtcgacccagatcgtgcccgccatcgtcggcgacgagggccgcgcc
ctggcgctggcggcaacgttggagcagcgcggcctgctggccgtggcgatccgcccgccc
acggtgccggccggaaccagccgcctgcgcatcgccctgagcgcggcgcaccgcgacgcc
gatatcgatcgcttgatagacggcctgacggccgcgctcgcctga

DBGET integrated database retrieval system