KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4682Help
Entry
AX27061_4682      CDS       T02964                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00361  Chlorocyclohexane and chlorobenzene degradation
axn00625  Chloroalkane and chloroalkene degradation
axn01100  Metabolic pathways
axn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AX27061_4682
   00361 Chlorocyclohexane and chlorobenzene degradation
    AX27061_4682
Enzymes [BR:axn01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AX27061_4682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AHC49139
Position
5172298..5173011
Genome map
AA seq 237 aa AA seqDB search
MPLDHLPRPQWLTFDCYGTLIQWDEGLQAAVARILAANQGAQRAPTPARFLRIYDEHEHR
LERTPPHRRFADITREALRLTMHDLGLAYRPQDAALLTDSISAMPPFPEVVDTLALLKRA
GFRLCIISNTDDAIIAGNVAQLGGHVDRVVTAEQAGAYKPSRRIFAHAHDSLGVTPDEVV
HICASPHLDHAAARDIGFRCVWIDRGTGRQPLPDYRPDATVSTLDQVPGLLRQAGWM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcccctggatcacctcccgcgcccgcaatggctcactttcgactgctacggcaccctg
atccaatgggatgaaggcctgcaagccgccgtggcccgcattctggccgccaatcagggg
gcacagcgcgccccgacgcccgcgcggttcctgcgtatctacgacgagcacgaacatcgg
ttggagcgcaccccgccccatcggcgtttcgccgacatcacgcgcgaagcgctgcggctg
accatgcacgatcttgggctcgcatatcgcccgcaggatgccgcgctgctcaccgacagt
atttcggccatgccgccatttcccgaagtcgtcgacacgcttgcgctgctcaagcgcgct
ggcttccgcctctgcatcatctccaataccgacgatgccatcatcgccggcaatgtggcg
caattgggcggtcacgtcgaccgcgtcgtcaccgccgaacaggcgggcgcctacaagccg
tcgcgccgcatctttgcccacgcccatgacagcctcggcgtcaccccggacgaagtcgtg
cacatttgcgccagtccccacctggaccatgccgccgcgcgcgacatcggctttcgctgc
gtgtggatcgaccgcggtaccggccgccagcccttgccggactaccgtcccgacgctacc
gtatcgactctggaccaagtacccgggctgttgcgccaggccggctggatgtag

DBGET integrated database retrieval system