KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5785Help
Entry
AX27061_5785      CDS       T02964                                 

Definition
(GenBank) Aspartyl-tRNA amidotransferase subunit C / Glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00970  Aminoacyl-tRNA biosynthesis
axn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AX27061_5785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:axn03029]
    AX27061_5785
Enzymes [BR:axn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AX27061_5785
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AX27061_5785
Mitochondrial biogenesis [BR:axn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AX27061_5785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AHC50238
Position
6360503..6360790
Genome map
AA seq 95 aa AA seqDB search
MARIARLARIELTPDQRGHAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHEDIVLRLR
QDAVTETASEARRAELLANAPDAQDGLFLVPKVLD
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcattgccaggctggccagaatcgaactgaccccggaccagcgcggccacgcg
caagccgagctcaatggcatcctccacctgatcgaacggctgcaggccgtcgacacccaa
ggcgtcgaacccctggcccacccgctgtccgcccacgaggacatcgtgctgcgcctgcgc
caggacgcggtcaccgaaaccgcctcggaggcccgccgcgccgaactgctggccaacgcc
cccgatgcccaggacggccttttcctggtccccaaggttctcgactaa

DBGET integrated database retrieval system