KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5933Help
Entry
AX27061_5933      CDS       T02964                                 

Definition
(GenBank) Aspartyl-tRNA synthetase / Aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:axn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AX27061_5933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:axn01007]
    AX27061_5933
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:axn03016]
    AX27061_5933
   03029 Mitochondrial biogenesis [BR:axn03029]
    AX27061_5933
Enzymes [BR:axn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     AX27061_5933
Amino acid related enzymes [BR:axn01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   AX27061_5933
Transfer RNA biogenesis [BR:axn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AX27061_5933
 Prokaryotic type
   Other AARSs
    AX27061_5933
Mitochondrial biogenesis [BR:axn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AX27061_5933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AHC50385
Position
complement(6527618..6529405)
Genome map
AA seq 595 aa AA seqDB search
MRTCYTGQVCRDHLGQTVTLYGWVNRRRDHGGVIFIDLRDRAGLAQIVFDPDNAAFATAE
RLRNEFCIRVTGLVRERPAGTANAELASGEIEVLCKEVEILNASVTPPFQLDDDNLSETT
RLTHRVLDLRRPQMQRNLMLRYRVSIETRKFLDQLGFIDIETPMLAKSTPEGARDYLVPS
RVNAGHFFALPQSPQLFKQMLMVSGFDRYYQITKCFRDEDLRADRQPEFTQIDCETSFLN
ELEIREIFENMIRHVFKVVQGVDLAEPFPIMTWTEAMRRYGSDKPDLRVQLEFTDMTDVM
RDVDFKVFAAAATAPGSRVVALRVPGGAEMSRSEIDAYTQFVGIYGAKGLAYIKVNEVAK
GRDGLQSPIVKNLHDAALAELVKRTGAQDGDIIFFGADREKVVNDAIGALRVKIGHSEFG
KKTGLFTAGWMPLWVVDFPMFEYDEEDGRYTAAHHPFTSPKDGHEDFLETDPSKAFAKAY
DMVLNGWEIGGGSVRIHREEVQSKVFRALKIGAEEAREKFGYLLDALQYGAPPHGGIAFG
LDRIVTMMTGAESIRDVIAFPKTQRAQDLLTQAPSEVDEKQLRELHIRLRNAEPK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacctgctacaccggccaggtttgccgcgaccatctcggccagaccgtcaccctg
tatggctgggtgaaccgccgccgcgaccacggcggggtcatcttcatcgacttgcgcgac
cgcgcgggcctggcgcagatcgtgttcgatccggataacgccgccttcgccaccgccgag
cgcctgcgcaacgaattctgcatccgcgtcaccggcctggtgcgcgagcgtccggcgggc
accgccaacgccgagctggcctcgggcgagatcgaggtgctgtgcaaggaagtcgagatc
ctgaacgcgtcggtcacgccgccgttccagctggacgacgacaacctgtcggaaaccacc
cgcctgacgcaccgcgtgctggacctgcgccgcccgcagatgcagcgcaacctgatgctg
cgctaccgcgtctcgatcgaaacccgcaagttcctggaccagctgggcttcatcgacatc
gaaaccccgatgctggccaagagcacgcccgaaggcgcgcgcgactacctggtgccctcg
cgcgtcaacgccggccacttcttcgcgctgccgcagtcgccgcagctgttcaagcagatg
ctgatggtgtcgggctttgaccgctattaccagatcaccaagtgcttccgcgacgaagac
ctgcgcgccgaccgccagcctgaattcacccagatcgactgcgaaacctcgttcctgaac
gagctcgagatccgcgagatcttcgagaacatgatccgccacgtgttcaaggtggtgcag
ggcgtcgacctggccgagccgttccccatcatgacctggaccgaagcgatgcgtcgctac
ggttcggacaagcccgacctgcgcgtgcagctcgaattcaccgacatgaccgacgtcatg
cgcgacgtggacttcaaggtgttcgccgccgccgccacggcgcccggcagccgcgtggtc
gccctgcgcgtgcccggcggcgccgagatgtcgcgcagcgagatcgacgcctacacccag
ttcgtcggcatctacggcgccaagggcctggcctacatcaaggtcaacgaagtggccaag
ggccgcgacggcctgcaatcgccgatcgtcaagaacctgcatgacgccgccctggccgaa
ttggtcaagcgcaccggcgcgcaggacggcgacatcatcttcttcggcgccgaccgcgag
aaggtcgtcaacgacgccatcggcgcgctgcgcgtgaagatcggccacagcgaattcggc
aagaagaccggcctgttcaccgccggctggatgccgctgtgggtggtcgacttcccgatg
ttcgaatacgacgaggaagacggccgctacaccgccgcgcatcacccgttcaccagcccc
aaggacggccacgaggacttcctcgagaccgatcccagcaaggcgttcgccaaggcctac
gacatggtcctgaacggctgggaaatcggcggcggctcggtccgtatccaccgcgaggaa
gtgcagagcaaggtgttccgcgcgctcaagatcggcgccgaggaagcccgcgagaagttc
ggctacctgctggacgcgctgcagtacggcgcgcctccgcacggcggcatcgccttcggc
ctggaccgcatcgtcacgatgatgaccggcgccgaatcgatccgtgacgtgatcgctttc
ccgaagacccagcgcgcccaggatctgctgacccaggcgccgtcggaagtcgacgagaag
caactgcgcgagctgcacatccgcctgcgcaacgctgagccgaagtga

DBGET integrated database retrieval system