KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5975Help
Entry
AX27061_5975      CDS       T02964                                 

Definition
(GenBank) Periplasmic divalent cation tolerance protein CutA
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Brite
KEGG Orthology (KO) [BR:axn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AX27061_5975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-ProteinID: AHC50427
Position
complement(6577366..6577713)
Genome map
AA seq 115 aa AA seqDB search
MLRDDDVVLVISNAPDLLLAKRIAHVLVEDGLAACVNLGAPGLSIYQWQGEVEGAEEIPI
HIKTTYARHQAVVQALAQMHPYDVPEIIVLPVIGGAAPYLDWVRQQTAAVQNKRD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgatgacgacgtcgtgctggtcatcagcaacgcgccggatctgttgctggcc
aagcgtatcgcccacgtgctggtcgaagatggcctggcggcctgcgtgaaccttggcgcg
ccgggtctgtccatctaccagtggcaaggcgaggtggaaggggccgaggaaatccccatc
cacatcaagaccacctacgcgcgccaccaggccgtggtccaggccctggcgcagatgcat
ccctacgacgtgcccgaaatcatcgtgctgccggtcatcggcggcgccgcgccctatctc
gactgggtgcgccagcagacggccgccgtgcagaacaagagagactga

DBGET integrated database retrieval system