KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_6010Help
Entry
AX27061_6010      CDS       T02964                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:axn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AX27061_6010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:axn03011]
    AX27061_6010
Ribosome [BR:axn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AX27061_6010
  Bacteria
    AX27061_6010
  Archaea
    AX27061_6010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AHC50462
Position
complement(6601579..6601908)
Genome map
AA seq 109 aa AA seqDB search
METTAIIRGVHISAQKTRLVADLIRGQKVGRALEILTFSPKKAAAILKKAVESAIANAEH
NDGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKVGA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactactgccattatccgtggggttcacatctccgctcaaaagacgcgtctggtt
gcggatctgatccgcggccagaaggtcggccgtgcgctcgagatcctcaccttctcgccg
aagaaggccgccgccatcctgaagaaggctgtcgagtccgccatcgccaacgccgagcac
aacgacggcgccgatatcgacgaactgaaagtcaccacgatcttcgtggacaaggctcag
tcgatgaagcgcttctccgctcgcgccaagggccgcggcaaccgtatcgagaagcagacc
tgccacatcacggtcaaggtcggagcttaa

DBGET integrated database retrieval system