KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_004821Help
Entry
NH44784_004821    CDS       T02785                                 

Definition
(GenBank) Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00072  Synthesis and degradation of ketone bodies
axo00280  Valine, leucine and isoleucine degradation
axo00650  Butanoate metabolism
axo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NH44784_004821
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    NH44784_004821
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NH44784_004821
Enzymes [BR:axo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     NH44784_004821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: CCH04466
Position
complement(501597..502250)
Genome map
AA seq 217 aa AA seqDB search
MAWSRDEMAARAARELQDGFYVNLGIGLPTLVANHVPKGVEVWLQSENGLLGIGPFPTDA
EVDADLINAGKQTVTTLPGSSIFSSADSFAMIRGGKINLAILGAMQVSEKGDLANWMIPG
KMVKGMGGAMDLVAGVGRVVVLMEHVAKKKDGTEDIKLLPECNLPLTGVGVVDLIITDLG
VMEVTDKGLKLLETAPGVTVDEIQSKTLAKLDVSAVK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcatggtcccgcgatgaaatggcggcgcgcgccgcgcgcgagctgcaagacggtttt
tacgtgaacctgggtatcggcctgccgaccctggtggccaaccacgtgcccaagggcgtc
gaagtctggctgcagtccgaaaacggcctgctgggcatcggcccgttcccgaccgacgcc
gaggtcgacgccgacctgatcaacgccggcaagcagacggtcacgacgctgcccggctcg
tcgatcttctcgtcggccgactcgttcgcgatgatccgcggcggcaagatcaacctggcc
atcctgggcgcgatgcaggtgtccgaaaagggcgacctggccaactggatgatcccgggc
aagatggtcaagggcatgggcggcgcgatggacctggtggccggtgtcggccgcgtggtc
gtgctgatggaacacgtggccaagaagaaagacggcaccgaggacatcaagctgctgccc
gaatgcaacctgccgctgaccggcgtgggcgtggtcgacctgatcatcaccgacctgggc
gtgatggaagtcaccgacaagggcctgaagctgctggaaacggcgccgggcgtcaccgtg
gacgagatccagtccaagacgctcgccaagctggacgtgtcggccgtcaagtaa

DBGET integrated database retrieval system