KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_004911Help
Entry
NH44784_004911    CDS       T02785                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00260  Glycine, serine and threonine metabolism
axo01100  Metabolic pathways
axo01110  Biosynthesis of secondary metabolites
axo01120  Microbial metabolism in diverse environments
axo01130  Biosynthesis of antibiotics
axo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH44784_004911
Enzymes [BR:axo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NH44784_004911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 BAT Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CCH04475
Position
complement(510359..511369)
Genome map
AA seq 336 aa AA seqDB search
MIDLRSDTVTRPSPAMLQAMVSAPLGDDVMGDDPTVIQLQQAVAERAGKAAGLFFPSGTQ
SNLAALMAHCERGDEYLVGQQAHTYKYEGGGAAVLGSIQPQPIEHAEDGTLPLEKLAAAL
KPEGDPHFARTRLLALENTFHGKLIPADYVRAATDWARAHGLATHLDGARVFNAAVASGK
PLAEMCAPFDSVSICFSKGLGAPVGSVLVGSAELIARARRWRKVLGGGLRQSGVLAAACL
YALEHNVERLAEDHANARLLAEGLRGIAGVRVLSQDTNMVFAEFEPARCDALTAALAADG
ILMRAVYGGPTRMVTHLDLSSDDVRRVIEAVARHLA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttgcgcagtgataccgtcacccggccgtccccggccatgttgcaggccatg
gtcagcgcgccgctgggcgatgacgtgatgggcgatgatcccaccgtcatccagctgcag
caagccgtggccgaacgcgcgggcaaggccgccgggctgttcttcccttcgggcacgcag
agcaatctggcggcgctgatggcgcattgcgagcggggcgatgagtatcttgtgggccag
caggcgcatacctacaaatacgaaggcggcggcgcggcggtgctgggcagcatccagccc
caacccatcgaacacgccgaggacggtacgctgccgttggaaaagctggcggccgctctc
aagcccgaaggcgatccccactttgcccgcacccgcctgctggcgctggaaaacacgttc
cacggcaagctgattcccgccgactacgtgcgcgccgctaccgactgggcccgcgcccat
ggcctggccacgcacctggacggcgcgcgcgtgttcaacgcggcggtggccagcggcaag
ccgctggccgagatgtgcgcgccgttcgattcggtgtcgatctgcttttccaaggggctg
ggcgcgccggtcggctccgtgctggtgggcagcgccgaactgatcgcccgcgcgcgccgc
tggcgcaaggtgctgggcggcggcctgcgccaatcgggcgtgctggcggcagcctgcctg
tatgcgctggaacacaatgtcgagcgcctggccgaagaccacgccaacgcgcgcctgctg
gccgaaggcctgcgcggcatcgccggcgtgcgggtgctgagccaggacaccaacatggtg
ttcgcggagttcgagccggcgcggtgcgatgccttgaccgccgcgctggcggccgacggc
atcctgatgcgcgccgtctatggcggcccgacgcgcatggtgacgcacctggacctgtcc
agcgacgacgtgcgccgggtgatcgaggccgtggcgcgccacctggcttga

DBGET integrated database retrieval system