KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_018371Help
Entry
NH44784_018371    CDS       T02785                                 

Definition
(GenBank) Selenide,water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00450  Selenocompound metabolism
axo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NH44784_018371
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:axo03016]
    NH44784_018371
Enzymes [BR:axo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     NH44784_018371
Transfer RNA biogenesis [BR:axo03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    NH44784_018371
 Prokaryotic Type
    NH44784_018371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS Tfb5
Motif
Other DBs
NCBI-ProteinID: CCH05808
Position
complement(1945832..1946893)
Genome map
AA seq 353 aa AA seqDB search
MTQDAASAAVPRLTSLSHGGGCGCKIAPGVLSQLLARFGPAASYPNLLVGTETADDAAVY
RLNDEQALIATTDFFMPIVDDPYDFGRIAATNALSDVYAMGGTPIMALAIVGMPINVLPH
GVIADILRGGESVCKEAGIPVAGGHSIDSVEPIYGLAAMGLVHPDRIKRNADARAGDVLV
LGKGLGVGILSAALKKNRLDADGYRVMIDTTTRLNRPGAALAAMDGVHAITDVTGFGLLG
HTLEMARGAGLTARLRREALPWLPGVQAFAAEGVVTGASGRNWASYGESVRLGADVSDVE
RALLTDPQTAGGLLVACDPQAAQAVLELFREQGFADAAVVGDMVAGDALVRVD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggatgcagcgtccgcggcggtgccgcgcttgacctcgctgtcgcacggcggc
ggctgtggctgcaagatcgcgcccggcgtgctgtcgcagctgctggcgcgcttcgggccg
gccgccagctaccccaacctgctggtgggcaccgagacggccgacgatgccgccgtctac
cggctcaacgacgagcaggcgctgatcgcgaccaccgacttcttcatgccgatcgtcgac
gatccctacgacttcggccgcatcgcggccaccaatgcgctgtcggacgtgtacgccatg
ggcggcacgccgatcatggcgctggccatcgtcggcatgccgatcaacgtgctgccgcac
ggcgtcatcgccgacatcctgcgcggcggcgagtcggtctgcaaggaggccggcattccg
gtggcgggcggccacagcatcgactcggtcgaaccgatctacggcctggcggccatgggg
ctggtgcatccggaccgcatcaagcgcaacgccgatgcgcgtgccggcgacgtgctggtg
ctgggcaaggggctgggcgtgggcatcctgtcggcggcgctgaagaagaaccggctggac
gccgacgggtaccgggtgatgatcgacaccaccacccgcctgaaccgccccggggcggcg
ctggccgcgatggacggggtccatgcgatcaccgacgtcaccggtttcggcctgctggga
catacgctggagatggctcgcggcgcggggctgaccgccaggctgcggcgcgaggccttg
ccctggctgccaggcgtgcaggccttcgccgccgaaggcgtggtcaccggcgcgtcgggc
cgcaactgggcgtcgtatggcgaatcggtgcggctgggcgcggacgtatccgatgtcgaa
cgggccttgctgaccgacccgcagaccgctggcggcctgttggtcgcctgcgatccccag
gcggcccaggcggtgctggaactgttccgcgagcagggcttcgcggacgccgcggtggtc
ggcgacatggtcgcgggcgacgcgctggtgcgcgtcgactag

DBGET integrated database retrieval system