KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_022811Help
Entry
NH44784_022811    CDS       T02785                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e
  KO
K02890  large subunit ribosomal protein L22
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:axo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NH44784_022811
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:axo03011]
    NH44784_022811
Ribosome [BR:axo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NH44784_022811
  Bacteria
    NH44784_022811
  Archaea
    NH44784_022811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: CCH06246
Position
2438268..2438597
Genome map
AA seq 109 aa AA seqDB search
METTAIIRGVHISAQKTRLVADLIRGQKVGRALEILTFSPKKAAAILKKAVESAIANAEH
NDGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKVGA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactactgccattatccgtggggttcacatctccgctcaaaagacgcgtctggtt
gcggatctgatccgcggccagaaggtcggccgtgcgctcgagatcctcaccttctcgccg
aagaaggccgccgccattctgaagaaggctgtcgagtccgccatcgccaacgccgagcac
aacgacggcgccgatatcgacgaactgaaagtcaccacgatcttcgtggacaaggctcag
tcgatgaagcgcttctccgctcgcgccaagggccgcggcaaccgtatcgagaagcagacc
tgccacatcacggtcaaggtcggagcttaa

DBGET integrated database retrieval system