KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_026371Help
Entry
NH44784_026371    CDS       T02785                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00130  Ubiquinone and other terpenoid-quinone biosynthesis
axo00627  Aminobenzoate degradation
axo01100  Metabolic pathways
axo01110  Biosynthesis of secondary metabolites
axo01120  Microbial metabolism in diverse environments
axo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NH44784_026371
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NH44784_026371
Enzymes [BR:axo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     NH44784_026371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CCH06600
Position
2803019..2803582
Genome map
AA seq 187 aa AA seqDB search
MRRLVVGITGATGSLYAVRMLQALRGVDDVETHLVVSASGVLNIKHELDVSRHDVYALAD
HVHSVRDVGATLASGAFQTAGMVIVPCSMRTLAAVAHGLSDNLITRAADVTLKERRRLVM
MVRETPFNLAHLRNMTAVTEMGGIVFPPLPAFYHRPASIEEMVDHTVARVLELFDIHVPG
PHWEGMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgactggtcgtcggcatcacgggggccaccggctccctgtacgcggtgcgcatg
ctgcaggcgctgcgtggcgtggacgacgtcgagacgcacctggtggtgtcggcctcgggc
gtgctgaacatcaagcacgaactcgatgtcagccgccatgatgtctacgcgctggccgac
cacgtgcacagcgtgcgcgatgtgggcgccacgctggccagcggcgcgttccagacggcc
ggcatggtcatcgtgccgtgctcgatgcgcacgctggcggccgtggcccatggcctgtcc
gacaacctcatcacgcgcgcagccgacgtcacgctcaaggagcgtcgccgcctggtgatg
atggtgcgcgaaacgcccttcaatctggcgcatctgcgcaacatgaccgccgtcaccgag
atgggcggcatcgtttttccgccgctgccggcgttctatcaccggccggccagcatcgag
gaaatggtggatcacaccgtggcccgggtgctggagctgttcgacatccatgtgcccggt
ccgcactgggaaggcatgaaataa

DBGET integrated database retrieval system