KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_061091Help
Entry
NH44784_061091    CDS       T02785                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00071  Fatty acid degradation
axo00072  Synthesis and degradation of ketone bodies
axo00280  Valine, leucine and isoleucine degradation
axo00310  Lysine degradation
axo00362  Benzoate degradation
axo00380  Tryptophan metabolism
axo00620  Pyruvate metabolism
axo00630  Glyoxylate and dicarboxylate metabolism
axo00640  Propanoate metabolism
axo00650  Butanoate metabolism
axo00900  Terpenoid backbone biosynthesis
axo01100  Metabolic pathways
axo01110  Biosynthesis of secondary metabolites
axo01120  Microbial metabolism in diverse environments
axo01130  Biosynthesis of antibiotics
axo01200  Carbon metabolism
axo01212  Fatty acid metabolism
axo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NH44784_061091
   00630 Glyoxylate and dicarboxylate metabolism
    NH44784_061091
   00640 Propanoate metabolism
    NH44784_061091
   00650 Butanoate metabolism
    NH44784_061091
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NH44784_061091
   00072 Synthesis and degradation of ketone bodies
    NH44784_061091
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NH44784_061091
   00310 Lysine degradation
    NH44784_061091
   00380 Tryptophan metabolism
    NH44784_061091
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NH44784_061091
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NH44784_061091
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NH44784_061091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axo04147]
    NH44784_061091
Enzymes [BR:axo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NH44784_061091
Exosome [BR:axo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NH44784_061091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCH10050
Position
6578250..6579539
Genome map
AA seq 429 aa AA seqDB search
MAFKPVYVVDGARTPFLKARSGPGPFAAGDLAVQAGRGLLLRQPYAPTDLDEVIVGCAAP
SADEVNIGRVIALRLGCGNKVPGWTVMRNCASGMQALDSAIANIQTGRSQLVLAGGTDAL
SHAPVLFSDDMVRWLASWYAARGIGARLATLGRLRLRHLAPVIGLLKGLTDPVVGLSMGQ
TAENVATRFGISRQAMDAYSAQSHARALAGRANGAFAEITPLIDTQGKLYPDDDGVREDS
TPEKLARLKPVFDKPWGNITAGNSSQVTDGAAMLVLASEEAVRRWNLRPLGRIVDSQWAG
LDPAMMGLGPVHAATPILQRHGLGLNDLDLWEINEAFAAQVLGCLAAWRDEAYCQEHFGT
PAWGALDPARLNVDGGAIAIGHPVGASGARIVLHLLEALKRRGARRGMAAICIGGGLGGA
MLVETLENR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcattcaaaccggtatacgtggtcgacggcgcccgcacccctttcctgaaagcgcgc
tcgggccccggcccattcgcggccggcgacctggcggtgcaggccggacgcggcctgttg
ttgcgccagccctatgcgcccacggacctggacgaggtcatcgtgggctgcgccgcgccc
tcggccgacgaagtcaacatcggccgcgtgatcgccctgcgcctgggttgcggcaacaag
gtgccgggctggacggtgatgcgcaactgcgcgtccggcatgcaggccctggattccgcc
atcgccaacatccagaccggccgctcgcagctggtgctggccggcggcaccgacgccctg
tcgcacgcgccggtgctgttctcggacgacatggtgcgctggctggccagctggtacgcg
gcccgcggcatcggcgccaggctcgccacgctcggccggttgcgcctgcgccacctggcg
ccggtgatcggcctgctcaagggcctgaccgaccccgtggtgggcctgtccatgggccag
accgccgagaacgtcgccacccgcttcggcatcagccgccaggccatggacgcctattcg
gcgcagagccacgcgcgcgcgctggccgggcgcgccaacggcgccttcgccgagatcacg
ccgctgatcgacacccagggcaagctgtacccggacgacgacggcgtgcgcgaggactcc
acgcccgaaaagctggccaggctcaagccggtgttcgacaagccctggggcaacatcacc
gccggcaacagctcgcaggtcaccgacggcgccgcgatgctggtgctggcctccgaggaa
gcggtgcggcgctggaacctgcgaccgctgggccgcatcgtcgacagccagtgggccggc
ctggatccggccatgatgggcctggggccggtgcatgccgccacgccgatcctgcaacgc
cacggcctgggcctgaatgacctggacttgtgggagatcaacgaagccttcgccgcgcag
gtgctaggctgcctggccgcctggcgggacgaggcctattgccaggaacacttcggcacg
ccggcctggggcgcgctcgacccggcccgcctgaacgtggacggcggcgccatcgccatc
ggccatccggtcggcgcctcgggcgcccgcatcgtgctgcacctgctggaggcgctcaag
cgccgcggcgcgcggcgcggcatggccgccatctgcatcggcggcggcctgggtggcgcg
atgctggtcgaaaccttggagaaccgctaa

DBGET integrated database retrieval system