KEGG   Achromobacter xylosoxidans C54: LH59_15640Help
Entry
LH59_15640        CDS       T03336                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axs  Achromobacter xylosoxidans C54
Pathway
axs00071  Fatty acid degradation
axs00072  Synthesis and degradation of ketone bodies
axs00280  Valine, leucine and isoleucine degradation
axs00310  Lysine degradation
axs00362  Benzoate degradation
axs00380  Tryptophan metabolism
axs00620  Pyruvate metabolism
axs00630  Glyoxylate and dicarboxylate metabolism
axs00640  Propanoate metabolism
axs00650  Butanoate metabolism
axs00900  Terpenoid backbone biosynthesis
axs01100  Metabolic pathways
axs01110  Biosynthesis of secondary metabolites
axs01120  Microbial metabolism in diverse environments
axs01130  Biosynthesis of antibiotics
axs01200  Carbon metabolism
axs01212  Fatty acid metabolism
axs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH59_15640
   00630 Glyoxylate and dicarboxylate metabolism
    LH59_15640
   00640 Propanoate metabolism
    LH59_15640
   00650 Butanoate metabolism
    LH59_15640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH59_15640
   00072 Synthesis and degradation of ketone bodies
    LH59_15640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH59_15640
   00310 Lysine degradation
    LH59_15640
   00380 Tryptophan metabolism
    LH59_15640
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH59_15640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH59_15640
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH59_15640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axs04147]
    LH59_15640
Enzymes [BR:axs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH59_15640
Exosome [BR:axs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH59_15640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIR52137
Position
3406105..3407286
Genome map
AA seq 393 aa AA seqDB search
MREAVIVSTARTPITKAQRGEFNLIAGPTLAAHAVRAAVERSGIDPALIEDAFIGCGYPE
GATGRNIGRQAVIRAGLPVGIGGATVNRYCASGLQAIASAAARIVMDGAPAVIAGGVELV
SQIRTRDDGVSGMDPWIVANKPELYLPMIETADIVAARYGISREAQDRFAAQSQARTEAA
QAAGRYREEIIAVTTTMAVTDRATGAVSEREVTVDKDTCNRPGTTYEALAKLAPVRGPDQ
FVTAGNASQLSDGAAACVLMEAAEAQRAGIRPLGAFRGLAIAGCEPDEMGIGPVYAVPKL
LARHGLKVEDIDLWELNEAFASQALYCQERLGIPMERLNVNGGSIALGHPFGVTGARLAG
HVLLEGRRRGARYAVVTMCVGGGMGAAGLFEIY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagccgtcatcgtctccaccgcccgcacgcccatcaccaaggcgcagcgcggc
gaattcaacctgatcgccgggccgaccctggccgcccacgcggtgcgcgccgcggtcgag
cgcagcggcatcgaccccgccctgatcgaggacgccttcatcggctgcggctaccccgaa
ggcgccaccggccgcaacatcggccgccaggcggtgatccgcgccggcctgccggtcggc
atcggcggcgccaccgtcaaccgctattgcgcctcgggcctgcaggccatcgcctcggcc
gcggcgcgcatcgtcatggacggcgcgcccgccgtcatcgccggcggcgtcgagctggtg
tcgcagatccgcactcgcgacgacggcgtcagcggcatggacccgtggatcgtggccaac
aagcccgagctgtacctgcccatgatcgagaccgccgacatcgtcgccgcgcgctacggc
atcagccgcgaggcgcaggaccgctttgccgcgcagagccaggcgcgcaccgaggcggcc
caggccgccggccgctatcgcgaggagatcatcgccgtcaccaccaccatggccgtcacc
gaccgcgccaccggcgcggtgtcggaacgcgaggtcacggtcgacaaggacacctgcaac
cggcccggcaccacctacgaggcgctggccaagctggcgccggtgcgcggcccggaccag
ttcgtgaccgccggcaacgcctcgcagctgtccgacggcgccgccgcctgcgtactgatg
gaagcggccgaggcgcagcgcgccggcatccgcccgctgggcgcgttccgcggcctggcg
atcgccggctgcgagcccgacgaaatgggcatcggcccggtctacgcggtgcccaagctg
ctggcgcgccacggcctgaaggtcgaggacatcgacctgtgggaactgaacgaagccttc
gcctcgcaggcgctgtactgccaggaacgcctgggcatcccgatggagcgcctgaacgtg
aatggcggctcgatcgcgctgggccacccgttcggcgtcactggcgcccgcctggctggc
cacgtgctgctggaaggccgccgccgcggcgcgcgctacgccgtcgtcaccatgtgcgtg
ggcggcggcatgggcgcggccggcctgttcgaaatctactga

DBGET integrated database retrieval system