KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_00018Help
Entry
ERS451415_00018   CDS       T04522                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00260  Glycine, serine and threonine metabolism
axx01100  Metabolic pathways
axx01110  Biosynthesis of secondary metabolites
axx01120  Microbial metabolism in diverse environments
axx01130  Biosynthesis of antibiotics
axx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ERS451415_00018 (ltaA)
Enzymes [BR:axx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ERS451415_00018 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CKG64471
UniProt: A0A0D6FCV6
Position
1:19076..20134
Genome map
AA seq 352 aa AA seqDB search
MTQRISVDSSSALVDLRSDTVTHPTAAMYERMRTAPIGDDGLDGDPSVRALEAHVAARLG
KEAGLFVPSCTMANLLAVLAQTQRNEQVVLESAAHMYTSERGAATFTGLFYQGVPGTDGA
MDLNRLEDAMQSGGHKLKTALVAMETSHNNAGGAVLPLDHMQAVHGMAQACGVPVHLDGA
RLFNAAVALGVAPAEITRHADTVSLCLSKGLSAPVGAVLTGTRPVMARARMLRRMLGGTQ
RQAGIMAAAGLEGVQTMGDRLVEDHARARRLSDGLNRLDPSLSATVPQTNIVQVETADTG
MTNAHWVTALESAGLLTRPWGRTRLRCVTHRHIDDEDIDRAIEAFKKVLASR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcggatttccgtcgactcttccagcgcactcgtcgacctgcgcagcgacacg
gtgacccaccccaccgccgccatgtacgagcgcatgcgcaccgccccgatcggtgacgac
gggctcgacggcgaccccagcgtgcgcgcgctggaggcccacgtggcggcgcgcctgggc
aaggaagccggactgttcgtgcccagctgcaccatggccaacctgctggccgtgctggcg
cagacccagcgcaacgagcaggtggtgctggagtccgccgcgcacatgtacacgtccgag
cgcggcgccgccaccttcaccggcctgttctaccagggcgtgccgggcaccgatggcgcc
atggacctgaaccgcctggaagacgcgatgcaatccggcggccacaagctcaagaccgcg
ctggtggcgatggaaacctcgcacaataacgccggtggcgcggtgctgccgctggaccac
atgcaggcggtccatggcatggcgcaggcctgcggcgtgccggtacacctggacggcgcg
cgtctgttcaacgccgccgtcgcgctgggcgtggcgccggccgagatcacgcgccacgcc
gacacggtgtcgctgtgcctgtccaaagggctgagcgcgccggtgggcgcggtgctgact
ggcacgcgcccggtgatggcgcgcgcccgcatgctgcgccgcatgttgggcggcacccag
cggcaggccggcatcatggccgcggccgggctggaaggcgtgcagaccatgggcgaccgg
ctggtcgaagaccacgcgcgcgcccgtcgcctgagcgacggcctgaaccgcctggacccg
tccttgtcggcgacggtgccgcagaccaacatcgtgcaggtcgagaccgccgataccggc
atgaccaatgcccattgggtcacggcgctggaaagcgcggggttgctgacgcgtccgtgg
ggccgcacgcggttgcgctgcgtgactcaccgccatatcgacgacgaggatatcgaccgc
gccatcgaggccttcaaaaaggtgctggcaagccgctga

DBGET integrated database retrieval system