KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_00369Help
Entry
ERS451415_00369   CDS       T04522                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
axx  Achromobacter xylosoxidans NCTC10807
Brite
KEGG Orthology (KO) [BR:axx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ERS451415_00369 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CKG75346
UniProt: A0A0D6FL08
Position
1:393366..393740
Genome map
AA seq 124 aa AA seqDB search
MKPYDLSVSVTPRFVPEQSDPGEQQYVFAYTVRITNTGEHPAQVISRHWIITDGNQRVQE
VRGLGVVGQQPLLAPGETFEYTSGCPLPTPVGTMRGTYHCVGENGIPFEVPISEFVLAMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccctacgacctgagcgtctctgtcactccgcgcttcgtgcctgaacagtccgat
cccggcgaacagcaatacgtgttcgcctataccgtgcgcatcaccaataccggggagcat
ccggcccaggtgatcagccgccactggattatcaccgatggcaaccagcgcgtgcaggaa
gtgcgcgggctgggcgtcgtgggccagcagcccctgctggcgcccggcgagaccttcgaa
tacaccagcggctgccccctgcccacgccggtcggcacgatgcgcggcacctatcattgc
gtcggcgagaacggcattccgttcgaagtgccgatttccgaattcgtcctggccatgccg
cgcaccctgcactga

DBGET integrated database retrieval system