KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_02533Help
Entry
ERS451415_02533   CDS       T04522                                 

Gene name
bsaA
Definition
(GenBank) Glutathione peroxidase homolog BsaA
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00480  Glutathione metabolism
axx00590  Arachidonic acid metabolism
axx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ERS451415_02533 (bsaA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ERS451415_02533 (bsaA)
Enzymes [BR:axx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ERS451415_02533 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA CheW
Motif
Other DBs
NCBI-ProteinID: CKH33281
UniProt: A0A0D6HFW4
Position
1:complement(2781387..2781881)
Genome map
AA seq 164 aa AA seqDB search
MSTIYDFSARDIHGADQPLAAYRGRVLLVVNVASKCGFTPQYSGLEELYRALRDDGLTVL
GFPCDQFGRQEPGNEAEILDFCTTQYDITFPLFAKIDVNGANADPLYRWLKGEKPGVFGT
EGIKWNFTKFLVGRDGQVIKRYAPTDTPAGLKDDIVRALAVPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatctacgatttttcggcccgcgacatccacggcgccgaccagccgctggcc
gcctaccgcggccgggtcctgctggtggtgaacgtggcctcgaaatgcggcttcacgccg
cagtattcgggcctggaagagctgtaccgcgccttgcgcgatgacggcctgacggtgctg
ggctttccctgcgaccagttcggccgccaggagcccggcaacgaggccgagatcctcgac
ttctgcaccacgcagtacgacatcaccttcccgctgttcgccaagatcgacgtcaacggc
gccaacgccgacccgctgtaccgctggctcaagggcgagaagcccggcgtcttcggcacc
gagggcatcaagtggaacttcaccaagttcctggtgggccgcgacggccaggtgatcaag
cgctacgcccccaccgacacgccggccgggctgaaggacgacatcgttcgcgccctggcg
gtccccgccgcctga

DBGET integrated database retrieval system