KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_02538Help
Entry
ERS451415_02538   CDS       T04522                                 

Gene name
pdxA2_2
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase 2
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Brite
KEGG Orthology (KO) [BR:axx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ERS451415_02538 (pdxA2_2)
Enzymes [BR:axx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     ERS451415_02538 (pdxA2_2)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     ERS451415_02538 (pdxA2_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Iso_dh
Motif
Other DBs
NCBI-ProteinID: CKH33429
UniProt: A0A0D6HFX1
Position
1:2785787..2786839
Genome map
AA seq 350 aa AA seqDB search
MNPVTAHAGLPAPALPLAITMGDPAGIGPEIVARTLLRARYAQCCVVVGDAGVMARALAP
LGAAARLRVVEDVAGIRAGWEAGEIRLLPSSRMPAPPPFGRIDAAAGQAAYQAICLAIDL
ARQGRVAGMVTAPVHKEALAAAGVPYPGHTEILAERGGAARVAMMLANGAIATVLVTIHC
SLRQAIERADFDAQLSAIRLAHQGGRALGAAAPRVAVAGLNPHAGEGGLFGDEEQRIIAP
AIAAARREGIDASGPWPGDTVFMQARQGRFDVVVAQYHDQGLIPVKYLGLEQGVNITLGL
PFVRTSPDHGTAFDIAGQGIADPASLQTAIDHALRLAANPPDAAASGHRA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgtgaccgcgcacgccggcctgcccgcgcccgccttgcccttggccatcacc
atgggcgatcccgccggcatcgggccggaaatcgtcgccaggaccctgctgcgggcgcgc
tacgcgcaatgctgcgtcgtcgtcggcgatgccggcgtgatggcgcgcgcgctggcgccg
ctgggcgcggccgcccgcctgcgggtggtggaagacgtggccgggatccgggccggatgg
gaggccggcgagatccgcctgttgccatcgtcgcgcatgccggcgccgccgccattcggg
cggatcgacgcggccgccggccaggcggcataccaggccatctgcctggccatcgacctg
gcgcgccagggccgggtggcgggcatggtcacggcgcccgtgcacaaggaagcgctggcc
gcggccggcgtgccgtaccccggccacaccgagatcctggccgaacgcggcggcgccgcg
cgcgtggcgatgatgctggccaatggggccatcgccacggtgctggtcaccatccattgc
tcgctgcgccaggccatcgagcgcgccgatttcgacgcgcaactgtcggcgatccggctg
gcgcaccagggcggccgcgcgctgggcgccgccgcgccgcgggtggcggtggccgggctg
aacccgcatgccggcgaaggcggcctgttcggcgacgaggaacaacgcatcatcgccccg
gccattgccgccgcgcgccgggaaggcatcgatgccagcggcccgtggccgggcgacacg
gtcttcatgcaggcgcgccagggccgtttcgacgtggtggtggcgcagtaccacgaccag
ggcctgatcccggtcaagtacctgggcctggaacagggcgtgaacatcacgctgggcctg
ccttttgtccgcaccagtcccgaccacggcacggcgttcgacatcgccggccagggcatc
gccgatcccgccagcctgcagaccgccatcgaccatgccttgcggctggccgccaacccg
ccggacgccgccgcgtccggccaccgcgcgtaa

DBGET integrated database retrieval system