KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_04106Help
Entry
ERS451415_04106   CDS       T04522                                 

Gene name
pcaF_3
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00071  Fatty acid degradation
axx00072  Synthesis and degradation of ketone bodies
axx00280  Valine, leucine and isoleucine degradation
axx00310  Lysine degradation
axx00362  Benzoate degradation
axx00380  Tryptophan metabolism
axx00620  Pyruvate metabolism
axx00630  Glyoxylate and dicarboxylate metabolism
axx00640  Propanoate metabolism
axx00650  Butanoate metabolism
axx00900  Terpenoid backbone biosynthesis
axx01100  Metabolic pathways
axx01110  Biosynthesis of secondary metabolites
axx01120  Microbial metabolism in diverse environments
axx01130  Biosynthesis of antibiotics
axx01200  Carbon metabolism
axx01212  Fatty acid metabolism
axx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERS451415_04106 (pcaF_3)
   00630 Glyoxylate and dicarboxylate metabolism
    ERS451415_04106 (pcaF_3)
   00640 Propanoate metabolism
    ERS451415_04106 (pcaF_3)
   00650 Butanoate metabolism
    ERS451415_04106 (pcaF_3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ERS451415_04106 (pcaF_3)
   00072 Synthesis and degradation of ketone bodies
    ERS451415_04106 (pcaF_3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERS451415_04106 (pcaF_3)
   00310 Lysine degradation
    ERS451415_04106 (pcaF_3)
   00380 Tryptophan metabolism
    ERS451415_04106 (pcaF_3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERS451415_04106 (pcaF_3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERS451415_04106 (pcaF_3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ERS451415_04106 (pcaF_3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axx04147]
    ERS451415_04106 (pcaF_3)
Enzymes [BR:axx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERS451415_04106 (pcaF_3)
Exosome [BR:axx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERS451415_04106 (pcaF_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CKH83738
UniProt: A0A0D6I5U3
Position
1:4503359..4504540
Genome map
AA seq 393 aa AA seqDB search
MFDHSGVSIVGSGHTPFGKLDALNLEQLIVMAANEAIEDAGVDPAEIDAIYLGHFNAGLV
PDAFPASLVHQAHPALRFKPATRCENACASGSAAIHAGLRAIQSGAAGTVLVIGVEKMTS
RSTPEVTEALACAGYKNDPRESAMSFPQQFARLAEKYAERYEDPLPVMAAIAAKNHANAL
RNPLAQLRRELDADFCNTISERNPMIAAPLRMTDCSPISDGAAAVILTCERRAPRYARQV
RFRAATQVNDMLPLEGRDLLAFEGPHRAMQRAYSDAGIQLQDLDFAEVHDCFTIAELLIY
EAMGLAAPGEGHRVLTEGTVRRDGDLPVNLSGGLKAKGHPVGATGVSMHALAYRQLTGRA
GDMQRPGAELGLVFNMGGMAVANYASVLEAVRA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcattcgggcgtttcgatcgtgggcagcggccatacgccgttcggcaaattg
gacgctctgaatcttgagcaactcatcgtgatggcggccaacgaggcgatcgaggacgcc
ggcgtcgatcccgccgagatcgacgcgatctacctggggcatttcaacgcggggctggtg
cccgatgccttccccgcctcgctggtgcaccaggcgcatccggccttgcgcttcaagccc
gccacgcgctgcgagaacgcctgtgcctcgggctcggccgcgatccacgccggcctgcgc
gcgatccagtcgggcgcggccggcaccgtgctggtgatcggcgtcgagaagatgacctcg
cgcagcacgcccgaggtgaccgaggcgctggcctgcgccggctacaagaacgatccgcgc
gaaagcgccatgagctttccgcagcagttcgcgcgcctggccgagaaatacgccgagcgc
tacgaggacccgctgccggtcatggccgccatcgccgccaagaaccacgccaatgcgctg
cgcaatccgctggcgcagctgcggcgcgagctggacgccgacttctgcaacacgatctcg
gaacgcaatcccatgatcgcggcgccgctgcgcatgaccgactgttcgcccatcagcgac
ggcgccgccgccgtcatcctgacctgcgagcggcgcgcgccgcgctatgcgcgccaggtg
cgctttcgcgccgccacccaggtcaacgacatgctgccgctggagggccgcgacctgctg
gcgttcgagggtccgcaccgcgccatgcagcgcgcctactcggacgccggcatccagctg
caggacctggacttcgccgaggtgcacgactgcttcaccatcgccgaactgctgatctac
gaggccatgggcctggccgcgcccggcgaagggcatcgcgtgctcaccgagggcacggtg
cgccgcgacggcgacctgccggtcaacctgtcgggcggactcaaggccaagggccacccg
gtcggcgccaccggcgtgtcgatgcacgcgctggcctaccgccagctgaccggccgcgcc
ggcgacatgcagcgccccggcgccgagctcgggctggttttcaacatgggcggcatggcc
gtggcgaactacgcgtcggtgctcgaggcagtgcgggcgtaa

DBGET integrated database retrieval system