KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_06079Help
Entry
ERS451415_06079   CDS       T04522                                 

Gene name
glcB
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx00620  Pyruvate metabolism
axx00630  Glyoxylate and dicarboxylate metabolism
axx01100  Metabolic pathways
axx01110  Biosynthesis of secondary metabolites
axx01120  Microbial metabolism in diverse environments
axx01200  Carbon metabolism
Module
axx_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:axx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERS451415_06079 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ERS451415_06079 (glcB)
Enzymes [BR:axx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ERS451415_06079 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase AsmA_1
Motif
Other DBs
NCBI-ProteinID: CKI25008
UniProt: A0A0D6IV31
Position
1:6674609..6676783
Genome map
AA seq 724 aa AA seqDB search
MTQRIQHHGLQVAANLSQFIEQEALPGSGLAADAFWKGFAALVHDLAPKNRALLAERDRL
QAELDAWHRAHPGPIADPAAYRQFLEGIGYLLPQPASVRATTDNVDTEISQQAGPQLVVP
VSNSRYALNAANARWGSLYDALYGTDAIPATPGDGGAGYNPERGRAVIARARAFLDEAAP
LAQGSHTDARGYTVENGQLKVALANGATTLKNPAQFTGYQGDAAAPGAILLKNNGLHFEI
QIDRTHTIGATDAAGVKDVLVEAALTTIMDCEDSVAAVDADDKVHIYRNWLGLMKGDLTE
AVTKVGKTFTRKLNPDRQYTRPDGSALTLHGRSLMFVRNVGHLMTNPAVLDRDGQEIPEG
ILDAVVTSLAALQDRDRKLNSRTGSVYIVKPKMHGPAEAAFASELFDRVEDLLGLPRNTL
KMGIMDEERRTSINLKACIAAAASRVAFINTGFLDRTGDEMHSSMEAGPMLRKGDMKSTA
WITAYERNNVLVGLDAGLRGRAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAWVPSPTA
ATLHALHYHQVDVQAVQQELERTRLDSVRDELLAGLLTVPVGDRSKWSAADIQQELDNNV
QGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVTNRDQVMETF
QRMAKVVDGQNAGDPHYLPMAGNFDGSLAFKAACALVFEGLTQPNGYTEPLLHKFRLEFK
AAQA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacgcatccagcaccacggcctgcaagtggcggccaatctcagccagttcatc
gaacaagaggcgctgcccggctccgggctggccgctgacgcgttctggaaggggttcgct
gccctggtgcatgacctggcgcccaagaaccgcgccctgctggccgaacgcgatcgcctg
caggccgaactcgacgcctggcatcgcgcccatcccggccccatcgccgatccggccgcc
taccgccagtttctggaaggcatcggctacctgttgccccaaccggccagcgtgcgcgcc
accaccgacaatgtcgacaccgagatttcgcagcaggccggcccgcaactggtggtgccg
gtgtccaactcccgctacgccctgaatgccgccaacgcgcgctggggcagcctgtacgac
gcgctgtacggcaccgacgccattcccgccacgcccggcgacggcggcgccggctacaac
cccgaacgcggtcgcgccgtcatcgcccgcgcccgcgccttcctggatgaggccgcgccg
ctggcgcagggctcgcacaccgacgcccgcggctacacggtcgagaatggccagctcaag
gtggcgctggccaatggcgccaccacgctcaagaacccggcccaattcaccggctaccag
ggcgacgcggcggctcccggcgccatcctgctcaagaacaacggcctgcatttcgagatc
cagatcgaccgcacccataccatcggcgccaccgacgcggccggcgtcaaggacgtgctg
gtcgaggccgcgctgaccaccatcatggattgcgaagactcggtcgccgcggtcgacgcc
gacgacaaggtccacatctaccgcaactggctcggcctgatgaagggcgacctgaccgaa
gccgtcaccaaggtcggcaagaccttcacccgcaagctcaatcccgaccgccagtacacg
cgtccggacggctcggccctgacgctgcacggccgttcgctgatgttcgtgcgcaacgtc
ggccacctcatgaccaatccggccgtgctcgaccgcgacggccaggagatcccggagggt
atcctcgacgccgtggtcaccagcctggcggcgctgcaggaccgcgatcgcaagctgaac
tcgcgcaccggttcggtctacatcgtcaaacccaagatgcacggccccgcggaggccgcg
ttcgccagcgagctgttcgaccgcgtcgaagacctgctgggcctgccgcgcaataccctg
aaaatgggcatcatggacgaagagcgccgcaccagcatcaacctcaaggcctgcatcgcg
gccgcggcgtcgcgcgtggcgttcatcaacaccgggttcctcgatcgcacgggcgacgaa
atgcattccagcatggaggccggccccatgctgcgcaagggcgacatgaagtccaccgcc
tggatcaccgcctacgaacgcaacaacgtgctggtcggcctggacgccggcctgcgcggc
cgcgcccagatcggcaagggcatgtgggccatgcccgacctgatggcagccatgctcgaa
cagaagatcggacatcccaaggccggcgccaacactgcctgggtgccttcgccgaccgcg
gcgacgctgcacgcgctgcactaccaccaggtggacgtgcaggcggtccagcaggaactc
gaacgcacccggctcgacagcgtgcgcgacgagttgctggcgggcctgctgacggtgccc
gtgggtgatcgctccaagtggtccgccgccgacatccagcaggaactggacaacaacgtc
cagggcatcctgggctacgtggtgcgatggatcgaccagggcgtgggctgctccaaggtg
ccggacatccacaacgtcggtctgatggaagaccgcgccacgctgcgcatctccagccag
cacatcgccaactggctgcgccacggcgtcaccaaccgcgaccaggtcatggaaaccttc
cagcgcatggccaaggtggtggacggccagaacgccggcgatccccattacctgccgatg
gccggcaacttcgacggctcgctggcgttcaaggcggcttgcgcgctggtgttcgaaggc
ctgacccagcccaacggctacaccgagccactgctgcacaagttccgcctggagttcaag
gccgcccaggcctga

DBGET integrated database retrieval system