KEGG   Achromobacter xylosoxidans A8: AXYL_00367Help
Entry
AXYL_00367        CDS       T01341                                 

Gene name
fadB1
Definition
(GenBank) enoyl-CoA hydratase 1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00360  Phenylalanine metabolism
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00627  Aminobenzoate degradation
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_00367 (fadB1)
   00650 Butanoate metabolism
    AXYL_00367 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    AXYL_00367 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_00367 (fadB1)
   00310 Lysine degradation
    AXYL_00367 (fadB1)
   00360 Phenylalanine metabolism
    AXYL_00367 (fadB1)
   00380 Tryptophan metabolism
    AXYL_00367 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_00367 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_00367 (fadB1)
   00281 Geraniol degradation
    AXYL_00367 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_00367 (fadB1)
   00627 Aminobenzoate degradation
    AXYL_00367 (fadB1)
   00930 Caprolactam degradation
    AXYL_00367 (fadB1)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_00367 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ADP13726
UniProt: E3HTA0
Position
385870..386646
Genome map
AA seq 258 aa AA seqDB search
MSESFVLVETRGRVGLLTLNRPKALNALNDQLMDELGAALLAFEADAGIGAVVITGSEKA
FAAGADIGAMKDWSYMDVYGGEYITRNWETLKRIKKPVIAAVAGYALGGGCELAMMCDII
IAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDLALTARMMGAEEAERAGLVSRV
VAADKLMEEAMDAATVIASMSLPSVMMAKECVNRAFEGSLNEGLLFERRVFHSLFATEDQ
KEGMAAFTEKRKPDFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcgtttgtgctggtcgaaacccggggccgcgtcggcctgctgacgctgaac
cgtcccaaggccctgaacgccttgaacgatcaactgatggatgagctcggcgcggccctg
ctggcgtttgaagcggatgccggtatcggcgccgtggtcatcaccggcagcgaaaaagcc
ttcgccgccggcgccgacatcggcgccatgaaagactggtcgtacatggacgtgtatggc
ggcgagtacatcacgcgcaactgggaaacgctcaagcgcatcaagaagcccgtgatcgct
gccgtggccggttacgccctgggcggcggttgcgaactggccatgatgtgcgacatcatc
attgccgccgacaacgccaagttcggccagcccgaaatcaagctgggcgtgatcccgggc
gccggcggcacccagcgcctgccgcgcgcggtgggcaaggccaaggccatggacctggcg
ctgaccgcccgcatgatgggcgccgaggaagcggaacgcgccggcctggtgtcgcgcgtg
gttgcggccgacaagctcatggaagaagccatggacgcggccaccgtcatcgcctccatg
tcgctgccttctgtcatgatggccaaggaatgcgtcaaccgcgccttcgaaggttcgctc
aacgaaggcctgctgttcgagcgccgcgtgttccattcgctgttcgcgaccgaagaccag
aaggaaggcatggcggctttcactgaaaagcgcaaaccggacttcaaacaccgttaa

DBGET integrated database retrieval system