KEGG   Achromobacter xylosoxidans A8: AXYL_00367
Entry
AXYL_00367        CDS       T01341                                 

Gene name
fadB1
Definition
(GenBank) enoyl-CoA hydratase 1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00360  Phenylalanine metabolism
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00627  Aminobenzoate degradation
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_00367 (fadB1)
   00650 Butanoate metabolism
    AXYL_00367 (fadB1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_00367 (fadB1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_00367 (fadB1)
   00310 Lysine degradation
    AXYL_00367 (fadB1)
   00360 Phenylalanine metabolism
    AXYL_00367 (fadB1)
   00380 Tryptophan metabolism
    AXYL_00367 (fadB1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_00367 (fadB1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_00367 (fadB1)
   00281 Geraniol degradation
    AXYL_00367 (fadB1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_00367 (fadB1)
   00627 Aminobenzoate degradation
    AXYL_00367 (fadB1)
   00930 Caprolactam degradation
    AXYL_00367 (fadB1)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_00367 (fadB1)
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Other DBs
NCBI-ProteinID: ADP13726
UniProt: E3HTA0
Position
385870..386646
AA seq 258 aa
MSESFVLVETRGRVGLLTLNRPKALNALNDQLMDELGAALLAFEADAGIGAVVITGSEKA
FAAGADIGAMKDWSYMDVYGGEYITRNWETLKRIKKPVIAAVAGYALGGGCELAMMCDII
IAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDLALTARMMGAEEAERAGLVSRV
VAADKLMEEAMDAATVIASMSLPSVMMAKECVNRAFEGSLNEGLLFERRVFHSLFATEDQ
KEGMAAFTEKRKPDFKHR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgagcgagtcgtttgtgctggtcgaaacccggggccgcgtcggcctgctgacgctgaac
cgtcccaaggccctgaacgccttgaacgatcaactgatggatgagctcggcgcggccctg
ctggcgtttgaagcggatgccggtatcggcgccgtggtcatcaccggcagcgaaaaagcc
ttcgccgccggcgccgacatcggcgccatgaaagactggtcgtacatggacgtgtatggc
ggcgagtacatcacgcgcaactgggaaacgctcaagcgcatcaagaagcccgtgatcgct
gccgtggccggttacgccctgggcggcggttgcgaactggccatgatgtgcgacatcatc
attgccgccgacaacgccaagttcggccagcccgaaatcaagctgggcgtgatcccgggc
gccggcggcacccagcgcctgccgcgcgcggtgggcaaggccaaggccatggacctggcg
ctgaccgcccgcatgatgggcgccgaggaagcggaacgcgccggcctggtgtcgcgcgtg
gttgcggccgacaagctcatggaagaagccatggacgcggccaccgtcatcgcctccatg
tcgctgccttctgtcatgatggccaaggaatgcgtcaaccgcgccttcgaaggttcgctc
aacgaaggcctgctgttcgagcgccgcgtgttccattcgctgttcgcgaccgaagaccag
aaggaaggcatggcggctttcactgaaaagcgcaaaccggacttcaaacaccgttaa

KEGG   Achromobacter xylosoxidans A8: AXYL_00399
Entry
AXYL_00399        CDS       T01341                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein 1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00360  Phenylalanine metabolism
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00627  Aminobenzoate degradation
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_00399
   00650 Butanoate metabolism
    AXYL_00399
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_00399
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_00399
   00310 Lysine degradation
    AXYL_00399
   00360 Phenylalanine metabolism
    AXYL_00399
   00380 Tryptophan metabolism
    AXYL_00399
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_00399
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_00399
   00281 Geraniol degradation
    AXYL_00399
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_00399
   00627 Aminobenzoate degradation
    AXYL_00399
   00930 Caprolactam degradation
    AXYL_00399
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_00399
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ADP13758
UniProt: E3HUD5
Position
420505..421338
AA seq 277 aa
MSDITLEHYSAYESLKLRRHPGGVLEVIMGAKGGKPGKLSTADDRMHRELADIWRDIDTD
PDTRVVVIRGEGKGFSGGGDLDLVQQMADDFDVRTRVWREARDLVYNIINCNKPIVSAMH
GAAVGAGLVAGLLADISIAARDARIIDGHTRLGVTAGDHAAIVWPLLCGMARAKYYLMLC
ETVTGEEAERIGLVSLCVDEAELIGRAFEVANKLAAGSQTAIRWTKYSLNNWLRMAGPSF
DTSLALEFMGFGGPDVREGIQSLRERRAPNFRPDSPF
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagcgacatcacgctggaacactattccgcctatgagtccctgaagctgcgccggcat
cccggcggggtgctggaggtgatcatgggcgccaagggcggcaagccgggcaagctgtcc
accgccgacgaccgcatgcaccgcgagctggccgacatctggcgcgacatcgacaccgat
cccgacacccgggtggtggtgatccgcggcgaaggcaagggcttttccggtggcggcgac
ctggacttggtgcagcagatggcggatgacttcgacgtgcgtacccgcgtctggcgcgaa
gcccgcgacctggtctacaacatcatcaattgcaacaagcccatcgtgtccgccatgcac
ggcgcggccgtgggcgcgggcctggtggcgggcttgctggccgacatctccatcgcggcg
cgcgacgcgcgcatcatcgacggccatacccgcctgggcgtgacggccggcgaccatgcc
gccatcgtctggccgctgctttgcggcatggcgcgcgccaagtattacctgatgctgtgc
gaaaccgtgaccggcgaagaagccgagcgcatcggtctggtgtcgttgtgcgtggacgag
gctgaactgatcggccgcgccttcgaagtcgccaacaagctggccgcgggttcgcagacc
gccatccgctggaccaagtattcgctgaacaactggctgcgcatggcgggtcccagcttc
gatacttcgctggcgctggaattcatgggctttggcggcccggacgtgcgcgaagggatc
cagtccctgcgcgaacgccgcgcgccgaacttccggccggattcgccgttctga

KEGG   Achromobacter xylosoxidans A8: AXYL_00883
Entry
AXYL_00883        CDS       T01341                                 

Definition
(GenBank) carnitinyl-CoA dehydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00360  Phenylalanine metabolism
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00627  Aminobenzoate degradation
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_00883
   00650 Butanoate metabolism
    AXYL_00883
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_00883
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_00883
   00310 Lysine degradation
    AXYL_00883
   00360 Phenylalanine metabolism
    AXYL_00883
   00380 Tryptophan metabolism
    AXYL_00883
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_00883
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_00883
   00281 Geraniol degradation
    AXYL_00883
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_00883
   00627 Aminobenzoate degradation
    AXYL_00883
   00930 Caprolactam degradation
    AXYL_00883
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_00883
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: ADP14231
UniProt: E3HHJ0
Position
946095..946862
AA seq 255 aa
MSDLIKVEVTDGIQIITINRPEAKNAINLETAQALAAALDQLDSRDDIRIGILTGGGGTF
SSGMDLKAFAKSGQRPYVEGRGFAGLNERPPKKPLIAAVEGYALAGGCEMALASDLIVAA
SNAKFGLPEVKRGLVAGAGGMLRLPRRLPYHIAMEVILTGEMLTAERAYSFGLVNRITEP
GAALAGALELARAIVENGPLAVQTAKSVVAQSGDWDQASMFDQQRPLIAHIFSSADAKEG
ATAFAEKRKPVWQGK
NT seq 768 nt   +upstreamnt  +downstreamnt
atgtcagacctgatcaaggtagaagtcaccgacggcatccagatcatcacgatcaaccgt
cccgaggccaagaacgccatcaacctggaaaccgcgcaggccctggccgcggcgctggac
cagctggacagccgcgacgacatccgcatcggcatcctgacgggcggcggcggcacgttt
tcgtcgggcatggacttgaaggccttcgccaagtcggggcagcgtccctacgtggaaggc
cgcggtttcgccggcctgaacgaacggcctcccaagaagccgctgatcgccgcggtggaa
ggctatgcgctggccggcggctgcgaaatggcgctggcgtccgacctgatcgtggcggcc
agcaatgccaagttcggcctgccggaagtcaagcgcggcctggtggccggcgctggcggc
atgctgcgcctgccgcgccgcctgccgtaccacatcgccatggaagtgatcctgacgggc
gaaatgctgacggccgagcgcgcctattccttcggcctggtcaaccgcatcaccgagccg
ggcgctgccctggccggcgcgctggaactggcccgcgccatcgtcgagaacggcccgctg
gcggtgcagaccgccaagagcgtagttgcgcagtcgggcgactgggaccaggccagcatg
ttcgaccagcagcgtccgctgattgcgcacattttttcgtcggccgacgccaaggaaggc
gccacggctttcgccgagaagcgcaagcccgtctggcaagggaaataa

KEGG   Achromobacter xylosoxidans A8: AXYL_04413
Entry
AXYL_04413        CDS       T01341                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein 21
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00360  Phenylalanine metabolism
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00627  Aminobenzoate degradation
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_04413
   00650 Butanoate metabolism
    AXYL_04413
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_04413
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_04413
   00310 Lysine degradation
    AXYL_04413
   00360 Phenylalanine metabolism
    AXYL_04413
   00380 Tryptophan metabolism
    AXYL_04413
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_04413
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_04413
   00281 Geraniol degradation
    AXYL_04413
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04413
   00627 Aminobenzoate degradation
    AXYL_04413
   00930 Caprolactam degradation
    AXYL_04413
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_04413
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ADP17732
UniProt: E3HF05
Position
complement(4718949..4719752)
AA seq 267 aa
MEYATLAVERHDSVCRISLARESARNAQSQQMLDELDDALTRAEQDDSVRVVVLAGRGAH
FSAGHDLKEAQAKRADFTVEERWEYESRRYYGYCMRIWDFPKPTVAQVQGACVAGGFMIA
NMCDLVVCSDTAYFSDPVGHTLAAAATEVLIHPWVMGLRKAKEMLYTGEKVDAQEALRIG
MVNRVVPEAELDAATLALAQRIAQAPPFGLRLIKRSLNRTADAQGFRTALSAHFDTHQLS
HLSEEFQAVRERGLAQAIQRNKKGEAA
NT seq 804 nt   +upstreamnt  +downstreamnt
atggaatacgccaccctggccgtcgagcggcacgactcggtatgccgcatcagcctggcg
cgcgaatccgcgcgcaacgcccaaagccagcagatgctggatgaactggacgacgcgctg
acgcgcgccgaacaggacgactcggtgcgggtcgtggtgctggccggccgcggcgcacac
ttttccgccggccacgacctgaaggaagcgcaggccaagcgcgccgatttcacggtggaa
gagcgctgggagtacgagtcgcgccgctactacggctactgcatgcgcatctgggacttt
cccaagccgacggtggcccaggtccagggcgcctgcgtggcgggcggcttcatgattgcc
aatatgtgcgacctggtggtgtgttccgacaccgcatacttttccgatccggtgggccac
acgctggcggcggccgcgaccgaggtgttgatccatccctgggtcatgggtctgcgcaag
gccaaggaaatgctctacaccggcgaaaaggtcgacgcccaggaagcgctgcgcatcggc
atggtgaaccgcgttgtgcccgaagccgaactggacgccgcgaccctggcgctggcgcag
cgcatcgcgcaggcgccgccctttggcctgcgcctgatcaagcgttcgctgaaccgcacg
gccgacgcgcagggcttccgcaccgccttgtcggcgcatttcgacacacaccagctgtcg
catctgagcgaggaattccaggccgtgcgcgaacgcggattggcgcaggccatccagcgc
aataagaagggcgaggcagcatga

KEGG   Achromobacter xylosoxidans A8: AXYL_04498
Entry
AXYL_04498        CDS       T01341                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein 22
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01200  Carbon metabolism
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_04498
   00650 Butanoate metabolism
    AXYL_04498
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_04498
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_04498
   00310 Lysine degradation
    AXYL_04498
   00380 Tryptophan metabolism
    AXYL_04498
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_04498
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_04498
   00281 Geraniol degradation
    AXYL_04498
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04498
   00930 Caprolactam degradation
    AXYL_04498
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AXYL_04498
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_04498
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AXYL_04498
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 AlaDh_PNT_C NAD_binding_2 Pyr_redox_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: ADP17817
UniProt: E3HH03
Position
4822726..4824684
AA seq 652 aa
MTTLDTLSHWRLDRDTDGLAWLTFDRAGSAVNALSADTMGELAVVLDALDAVPPAGLIIQ
SGKATGFIVGADVNEFASLDTPEQARALVARGWNLFNRLAAVRYPTLALIQGHCLGGGLE
LALACRYRLVADQPGTSLALPEVMLGIFPGWGGMLRLPQLIGAPAALDMMLTGRGADARR
AAALGLADARVPPRLLLAAARQTVLSRKAPRRARGFGGWANRWPLKAIVASRARKQIAAK
DPLGHYPAAPAIVDIWEKHGGNALQAPALIDRIISSDTARNLLRVFRLQDRLKANGKQAG
IAPARHVHVVGAGVMGGDIAAWCALKGMTVTLQDQDMARIAPAIKRAAQLYSRRLKDPRL
ARAAFDRLMPDPAGGGVPLADIVIEAISEQPEAKRALYRSLEPRMKADALLATNTSSLAL
ETLRAGLAHPERLVGIHFFNPAAKMPLVEVVHAEGDAGDAQARACAFVGQIDKLALPVKS
APGFLVNAVLAPYMLEAMRSVDEGLAPEAVDAAMVAFGMPMGPLELADTVGLDIARAAGE
ELAGGAEPPRCLAERLARGDLGKKSGRGFYIWRDGKPAKGASPAGAPAGLAQRLIQPLID
ATRQRVDAGIVADADLADAGVIFGTGFAPFTGGPLHYQSSKALRDIRPAEAD
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgacgacactggatacgctatcccactggcgcctggaccgcgataccgacggcctggcg
tggctgaccttcgaccgcgccggcagcgcggtcaatgccttgtccgccgacaccatgggc
gagctggcggtggtgctggatgcgctggacgcagtcccgcccgcggggttgatcatccag
tccggcaaggccacgggcttcatcgtgggcgccgacgtcaatgaattcgccagcctggac
acgccggaacaggcgcgcgcgctggtcgcgcgcggctggaatctcttcaaccgcctggcc
gcggtgcgctatccgacgctggcgctgatccagggccactgcctgggcggcggcctggag
ctggcgctggcctgccgctaccggctggtggcggaccagcccggcacctcgctcgcgctg
cccgaagtgatgctggggattttccccggctggggcggcatgctgcgcctgccgcaactg
ataggcgcgcccgccgcgctcgacatgatgctgaccggccgcggcgccgacgcgcgccgc
gccgccgcattgggtcttgccgacgcgcgcgtgccgccgcgcctgctgctggccgccgcg
cgccagacggtgctgtcgcgcaaggcgccgcgccgcgcgcgcggcttcggcggctgggcc
aaccgctggccgctcaaggccatcgtcgccagccgcgcccgcaagcagatcgccgccaag
gatccgctgggccactatcccgccgcgcccgccatcgtcgatatctgggaaaaacacggc
ggcaacgccctgcaggcgcccgcgctgatcgaccgcatcatttcctccgacaccgcccgc
aacctgctgcgggtgttccgcctgcaggaccggctgaaggccaacggcaaacaggccggc
atcgcgcccgcgcgccatgtgcacgtggtgggcgccggggtgatgggcggcgatatcgcc
gcctggtgcgcgctcaagggcatgacggtcaccttgcaggaccaggacatggcgcgcatc
gcgccggccatcaagcgcgccgcccagctgtactcgcgccgcctgaaggatccgcggctg
gcgcgcgcggcgttcgaccgcctgatgcccgacccggcgggcggcggcgtgccgctggcc
gacatcgtcatcgaagccatcagcgaacagcccgaggccaaacgcgcgctctaccgttcg
ctggaaccgcgcatgaaggccgatgccctgctcgccaccaacacctccagcctggcactg
gagaccttgcgcgcaggccttgcgcacccagaacgtctggtgggcatccacttcttcaat
cccgcggccaagatgcccctggtggaggtggtgcacgccgaaggcgacgcaggcgacgcg
caagcccgcgcctgcgccttcgtcgggcagatcgacaagctggcgctgccggtcaagagc
gcgccgggcttcctggtcaacgccgtgctggcgccctatatgctggaggccatgcgcagc
gtggatgaaggcttggcgcccgaggccgtggacgcggccatggtcgccttcggcatgccg
atgggaccgctggagctggcagataccgtgggcttggacatcgcgcgcgcggcaggcgag
gaacttgctggcggcgccgagccgccgcgctgcctggccgagcgcctggcgcgcggcgac
ctgggcaagaagagcggccgcggcttctacatctggcgcgacggcaagccggccaagggc
gccagccccgccggcgcgcccgccggactggcgcagcgcctgatccagccgctgatagac
gccacgcgccagcgcgtggacgcgggcatcgtcgccgacgccgacctggcggacgcgggc
gtgattttcggaacggggttcgcgccattcacgggcggccccttgcattaccagagcagt
aaagcattgcgcgatataagaccggctgaggccgattag

KEGG   Achromobacter xylosoxidans A8: AXYL_04519
Entry
AXYL_04519        CDS       T01341                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein 23
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00360  Phenylalanine metabolism
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00627  Aminobenzoate degradation
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_04519
   00650 Butanoate metabolism
    AXYL_04519
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_04519
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_04519
   00310 Lysine degradation
    AXYL_04519
   00360 Phenylalanine metabolism
    AXYL_04519
   00380 Tryptophan metabolism
    AXYL_04519
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_04519
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_04519
   00281 Geraniol degradation
    AXYL_04519
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04519
   00627 Aminobenzoate degradation
    AXYL_04519
   00930 Caprolactam degradation
    AXYL_04519
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_04519
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ADP17838
UniProt: E3HH24
Position
complement(4848596..4849318)
AA seq 240 aa
MSGVLRIDKQGAAYVLTLSRPDKMNALSAELVEALIAALDEAESGGAQLIVLKGEGRNFS
AGFDFGGWQEQSEGDLLLRFVRIEMLLQRLAASPCLTLGLAHGRNFGAGVDLFGACKWRI
STPDATFRMPGLKFGLVLGTRRYAALVGAERARAVLEQAATFSAEEALRDGFASRLADAP
DWQDVERDALDAASALSSASRVQLYAALSAETPDTDLARLVRSAAQPGLKGRVAAYLQAR
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagtggcgtcctgcgcatcgacaagcagggcgcggcctacgtgctgacgctgtcgcgg
cccgacaagatgaatgccttgtcggccgaactggtggaagcgctgatcgccgcgctggat
gaggccgagtccggcggcgcacagctcatcgtgctcaagggtgaaggcaggaacttcagc
gcgggcttcgacttcggcggctggcaggaacagagcgaaggcgatctgctgctgcgcttc
gtgcgcatcgagatgctgttgcagcggctggcggcctcgccctgcctgacgctggggctg
gcgcatggccgcaacttcggggcgggcgtggacctgttcggcgcctgcaagtggcgcatc
agcacgccggacgccaccttccgcatgcccggactgaagttcgggctggtgctgggcacc
cgccgttacgcggccctggtgggcgcggagcgggcgcgcgcggtgctggagcaggcggcc
acgttcagcgcggaagaagccttgcgcgacggcttcgccagccgcctcgccgacgcgccg
gattggcaggacgtcgagcgcgacgcgctcgacgccgcgtccgcgctgagcagtgcgagc
cgcgtgcagttgtacgcggcgctgtcggcggaaacgcccgacaccgatcttgcccgcctg
gtgcgctccgccgcccagccgggattgaagggccgggtggccgcgtatctgcaggcgcgc
tga

DBGET integrated database retrieval system