KEGG   Achromobacter xylosoxidans A8: AXYL_01093
Entry
AXYL_01093        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
Organism
axy  Achromobacter xylosoxidans A8
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-ProteinID: ADP14437
UniProt: E3HKR2
Position
1164727..1165452
AA seq 241 aa
MKPSIILYAFLLGSMQLPAWAQQPATTPARNAQSQERPLAARILDDRVAGEWGLQPQEWA
RYRDLMDGPLGIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDE
AWQRLNPGMQRVNLSDERPGAAAARGSGRTAVFIKDGCAACGQLVQRLQSSGAEFDLYMV
GSRQDDARIRDWAKRAQIDPARVRSGGITLNHDGGRWLSLSLPGDLPAVVREVNGQWQRQ
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagccgtcgatcatcctgtacgcgttcctgctgggctccatgcagttgcccgcctgg
gcgcagcagcccgccacgacccccgcccgcaatgcgcagagccaggagcgcccgctggcc
gcccgcatcctggacgaccgggtggcaggcgaatggggcctgcaaccgcaggaatgggcg
cgctatcgcgacttgatggatgggccgctgggcatctactcgccaaatctggacccgctg
tccgccctgggcatcgaggcgcgcaccgacgaagaacggcggcgctacgcagagctgcag
gtgcaagtcgaagcgcgccgcgtggagaagctgctcgcgtaccagcgcgcctacgacgag
gcctggcagcgcctgaaccccggcatgcagcgggtgaacctgtctgacgagaggccaggc
gccgccgctgcgcggggcagcggtcgcacggcagtgttcatcaaggacggctgcgcggct
tgcgggcaactcgtccaacgcctgcaatcctcgggtgccgagttcgacctttacatggtc
ggcagccgccaggacgatgcgcgcatccgcgactgggccaagcgcgcccagatcgacccg
gcccgggtgcgcagcggcggcatcacgctcaaccacgacggcggccgctggctgtcgctg
agcctgcccggcgatttgcctgcggttgtgcgcgaagtgaacggccaatggcaacgccag
ccgtaa

DBGET integrated database retrieval system