KEGG   Achromobacter xylosoxidans A8: AXYL_01098
Entry
AXYL_01098        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
Organism
axy  Achromobacter xylosoxidans A8
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ADP14442
UniProt: E3HKR7
Position
1169599..1169982
AA seq 127 aa
MLASIWLRAAHRGVPTFLVTALVLGRSPMALAESPAQRQELVAALRQLDALERTVADSAA
HTPITPGERYHFDYPRLQADLARVRAGIQFHLTPSRAQPRAPSELAGEYRTERATEPLPA
TTAEGKQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atgttggcttcgatctggctgcgcgccgcgcatcgcggcgtgcccacttttctcgtgacg
gccctcgtgctgggccggtccccgatggccttggccgagtccccggcgcagcgccaggag
ttggtcgccgcgctgcgccagctcgacgcgctggaacgcaccgtcgcggacagcgccgcg
catacccccatcacaccgggcgagcgctaccacttcgattacccgcggctccaggctgac
ttggcgcgcgtgcgcgccggcatccaatttcacctgacgccatcgcgcgctcaaccgcgc
gccccctccgaactggccggcgaataccgcaccgaacgggcgaccgagccgctgccggcg
acgactgcggagggcaagcaatga

DBGET integrated database retrieval system