KEGG   Achromobacter xylosoxidans A8: AXYL_01102
Entry
AXYL_01102        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
Organism
axy  Achromobacter xylosoxidans A8
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ADP14446
UniProt: E3HKS1
Position
1170995..1171687
AA seq 230 aa
MSRFKNEITHLQAHIKTLRLAAGALVVVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWW
EVPPESVYAFTFYVFQTLNRWPTNGEEDYSRNLHTLSPYLTPSCQAFLRADYDYRRSTGE
LRQRVRGIYEIPGRGYGDDPTARVRTVSDRDWVVTLDITADEYYGAEQVKRALVRYPIKV
TRVDVDPARNPFGLALDCYDGAPQRISAPEPTRPAPSGLSPQAPQGGNTP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagccgcttcaaaaacgagatcacccacctgcaggcgcacatcaagaccttgcggctg
gccgcgggcgcgctggtcgtcgtcgccctggtcatgggcggcggctggtggagcgcgccg
cgcgacctgaccatccacgtcccgcccgacctgcgctctggcagtacccgcaagtggtgg
gaagtgccgcccgaatcggtctatgcgttcacgttctacgtgttccagacgctgaaccgc
tggccaaccaatggcgaggaagactactcgcgcaacctccacacgctctcgccgtacctc
accccgtcctgccaggccttcctgcgggcggactatgactaccgccgctccacgggcgag
ctgcgtcagcgcgtgcgcggcatctacgagattcccggccgcggctatggcgacgacccc
acggcgcgcgtgcgcaccgtgtccgatcgcgactgggtggtgacgctggacatcacggcg
gacgagtactacggcgccgagcaggtcaagcgcgccctggtgcgctatccgatcaaggtc
acgcgggtggacgtcgatcccgcccgtaacccgttcggcctggcgctggactgctacgac
ggcgcgccccagcgcatcagtgcaccggagccgacgcgcccggcgccgagtggcctgtct
ccgcaagcgcctcaaggaggaaacaccccatga

DBGET integrated database retrieval system