KEGG   Achromobacter xylosoxidans A8: AXYL_01105
Entry
AXYL_01105        CDS       T01341                                 

Definition
(GenBank) signal recognition particle GTPase
Organism
axy  Achromobacter xylosoxidans A8
SSDB
Motif
Pfam: SsgA
Other DBs
NCBI-ProteinID: ADP14449
UniProt: E3HKS4
Position
1173984..1174433
AA seq 149 aa
MHSNLTNLARGLALALAVAVLGGCATSKEKLLTHGDRTMMDIWQQEAGDGGGAAGRNAGR
QLLDARQSLRRPLTDADVQVAPVEQMRYTRTARNEVHRQFQRLPNPDLVMYVYPHLAGTD
PVPVPGYTTVFPLNQRIQYAMPGERVEAY
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcactcgaacttgactaacctggcccgtggcctggcactggccctcgccgtcgcggtg
cttggcggctgcgccaccagcaaggaaaagctgctgacccacggtgaccgcacgatgatg
gacatctggcagcaggaggccggcgacggcggtggcgcagccggacggaacgccggccgc
cagctgctcgatgcgcgccagagcctgcgtcggcccctgaccgacgccgacgtgcaggtc
gcacccgtcgagcagatgcgctacacgcgcaccgcgcgcaatgaggtccaccgccagttc
cagcgtctgcccaatcccgatctcgtcatgtacgtgtatccgcacctggcgggcacggac
cccgtgccggtgccgggctacacgacggtcttcccgctcaaccagcgcatccagtacgcc
atgccaggcgagcgcgtggaggcctactga

DBGET integrated database retrieval system