KEGG   Achromobacter xylosoxidans A8: AXYL_01111Help
Entry
AXYL_01111        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
Organism
axy  Achromobacter xylosoxidans A8
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADP14455
UniProt: E3HKT0
Position
1180342..1181736
Genome map
AA seq 464 aa AA seqDB search
MKRPEPMNLSAKACRLLRPTALAGTLALVCGMAWAQVGYQNSGPVLGDDVMYSIGGGSAV
SMGRAAGMRSIGVGVGWNSNLICGDMSIQTTLRNQLNGITNGFQQIMSNVIQSATSAVAS
LPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGMA
LRDAVGSNDAVSAVEQAETRRGNDGVPWVGGSNAGGAGQSAIRVVGDVTRAGYNLVNGRG
VTDTSSIASTSCASLSCQTWTSPQQATEWATRALGEQVQRTCDSCTKTETVPGVGLTPLI
QEEYEAKLEVLQELVSGTRNTTFENLREAGSTSLPITRGVIEALRDEPDQDLLARRLASE
VALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGARP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtcctgaaccgatgaacctttccgccaaggcgtgccgcctgctgcgcccgacg
gcgctggccggcacgctcgctctggtctgcggcatggcgtgggcgcaggtcggataccag
aacagcggccccgtcctcggcgatgacgtcatgtactcgatcggcggtggcagtgcggtg
tccatgggccgcgcggccggcatgcgttccatcggggtcggcgtggggtggaacagcaac
ctgatctgcggcgacatgagcatccagaccacgctgcgcaatcagcttaacggcatcacg
aacggctttcagcagatcatgagcaacgtgatccagagcgcgaccagcgcggttgcatcg
ctgccggcgctgatcattcagcgcgccgatccgggcctgtacaacctgctgactaacggc
gtgctgcaggcgcggctggacttcgaccgctccaagctgacgtgccgcgccatggcggag
aagatggccgagacggcgggtggccagcttggctggagccagatggccgaaggcatggcc
ctgcgtgacgcggttggcagcaacgatgccgtatcggccgtcgagcaggccgagacgcgc
cgcggcaacgacggcgtgccctgggtgggcggcagcaatgccggtggcgcgggccagtcc
gccatccgggtggtcggcgacgtcacccgcgcgggctacaacctggtcaacggtcgcggc
gtgacggacacctcctccatcgcgtccaccagttgcgcgagcctgtcctgccagacctgg
acgtcgccgcagcaggcgaccgaatgggccacgcgcgccctcggagagcaggtgcagcgc
acgtgcgactcctgcactaagaccgagacggtgcccggcgtcgggctgacgccgctgatc
caggaggagtacgaagccaagctggaggtcttgcaggagctggtttccggcacgcgtaat
accaccttcgagaacttgcgcgaggccggcagcacgtcgctgccgatcacccgcggcgtg
atcgaggcgctgcgcgacgagccggaccaggacctgctggcgcggcgcctcgcgtccgaa
gtggcgctgtcatcggtgctggagaaggcgctcctgctccaacgcacgctgctcacgggc
aagaaggagcccaacgtcgcagccaacgaacttgcggtgcaggccgtgaaccatgagagc
gacacgctcgaccgggagatccgcaacctgaagacggaattggagctgcggcgcgaactg
gcgaacaactcgccgatggccatcatccagcgccacggcacgcgggcggccggctcgcgc
ggcatctacgagggcgatccggtacccgaccgccttgaccagttgcagaagggcaatccc
ggagccaggccatga

DBGET integrated database retrieval system