KEGG   Achromobacter xylosoxidans A8: AXYL_01582Help
Entry
AXYL_01582        CDS       T01341                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00260  Glycine, serine and threonine metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_01582 (ltaE)
Enzymes [BR:axy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AXYL_01582 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 BAT Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADP14920
UniProt: E3HTF7
Position
1676901..1677911
Genome map
AA seq 336 aa AA seqDB search
MIDLRSDTVTRPSAAMLQAMVSAPLGDDVMGDDPTVIRLQEAVAERTGKAAGLFFPSGTQ
SNLGALMAHCERGDEYLVGQLAHTYKYEGGGAAVLGSIQPQPIEHAEDGSLPQEKLAAAL
KPEGDAHFARTRLLALENTFHGKLIPADYVQAATDWARQHGLATHLDGARVFNAAVASGK
PVADLCQPFDSVSLCFSKGLGAPVGSVLVGSTELIARARRWRKMLGGGLRQAGVLAAACL
YALEHNVERLADDHENARLLAEGLRGIPGVKVLSQDTNMVFAEFEPARCEELTAKLAADG
IQMRAVYGGPTRLVTHLDVSAADVRQVVQAVARHLA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctgcgtagcgacaccgtcacccggccatccgcggccatgctgcaagccatg
gtatccgcgcccctgggcgatgacgtgatgggcgacgacccgaccgtgatccgtctgcag
gaggcggttgccgaacgcaccggcaaggcggcgggcctgttctttccgtccggcacgcaa
agcaatctgggggcgctgatggcccactgcgagcgcggcgacgagtatctggtgggccag
ctcgcgcacacctacaagtatgaagggggcggcgcggccgtgctgggcagcatccagccg
cagccgatcgagcacgcggaggacggctccctgccgcaggaaaagctggccgcggcgctc
aagcccgagggcgatgcgcacttcgcccgcacccgcctgctggcgctggaaaacaccttc
cacggcaagctgatccccgccgactacgtgcaggctgcgaccgactgggcgcgccagcac
ggactggccacccatctggacggcgcccgcgtgttcaatgccgcggtggccagtggcaag
ccggtggcggacctgtgccagcccttcgattcggtgtccctctgcttttcgaaaggcttg
ggcgcgccggtgggttcggtgctggtgggcagcaccgagctgatcgcccgcgcccgccgc
tggcgcaagatgctgggcggcggcctgcgccaggctggcgtgctggccgcggcctgcctg
tatgcgttggagcacaacgtggagcgcctggccgatgaccacgagaacgcccgcctgctg
gcggaggggctgcgcggcattccgggcgtcaaggtattgagccaggacaccaacatggtg
ttcgctgaattcgagcctgcgcgttgcgaggaactcacggccaaactggccgccgacggc
atccagatgcgggccgtctacggcggcccgacgcgcctggtcacgcacctggacgtgtcc
gccgcggacgtgcggcaggtggttcaggcggtggcgcggcacctggcatag

DBGET integrated database retrieval system