KEGG   Achromobacter xylosoxidans A8: AXYL_02409Help
Entry
AXYL_02409        CDS       T01341                                 

Definition
(GenBank) AMP-binding enzyme family protein 9
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00620  Pyruvate metabolism
axy00640  Propanoate metabolism
axy00680  Methane metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_02409
   00620 Pyruvate metabolism
    AXYL_02409
   00640 Propanoate metabolism
    AXYL_02409
  Energy metabolism
   00680 Methane metabolism
    AXYL_02409
Enzymes [BR:axy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AXYL_02409
Lipid biosynthesis proteins [BR:axy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AXYL_02409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADP15730
UniProt: E3HM28
Position
2551469..2553091
Genome map
AA seq 540 aa AA seqDB search
MLSRADSYTQLASQFQWQVPAAYNIGVDACDKWADGSGRLALIYEKSDGAQSRYTFDQIK
ALSNRLAHSLERHGVKRGDRVAVYLPQAPETAVTHIAVYKMGAVAVPLFTLFGVDAIQYR
LANSGAAALVTDAEGCRKLREIRASLPDLKVVYCIDPDCPDDAVPFHAALAAESDDYTPA
ATAADDPAVIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSHEFFPENAALMWTPADWAWI
GGLLDVLLPSWHHGVPVLARRFEKFDGASAFELMARHGVTHTFLPPTALKMMRGTELPAG
AGALALRSVASGGESLGAELIDWGRRVLGVTINEFYGQTECNMLVSSCSSLFDPCIGAIG
RAAPGHRVAIVDDSGVEVADGQEGNIGVLRPDPVMFLGYWNNPEATAEKFAGDYLLTGDQ
GVRDAEGFIRFVGRNDDVITSAGYRIGPGPIEDCLIGHPAVRMAAVVGVPDAQRTEIVMA
YVVLNEGYEGNDALVKDLQAHVRKRLAAHEYPRAIRFVTSLPTTATGKIIRRELRDGSYS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccagagccgattcctacacgcagcttgcgtcccagttccaatggcaggtgcct
gcggcctacaacatcggcgtcgacgcctgcgacaaatgggccgacggcagcggccgcctg
gcgctgatctacgagaagagcgacggcgcgcaatcgcgctacacgttcgatcagatcaag
gcgctgtccaaccgcctggcgcacagcctggaacgccatggcgtcaagcgcggcgaccgc
gtcgccgtctacctgccgcaggccccggaaaccgcggtgacccatatcgccgtctacaag
atgggcgcggtggcggtgccgctgttcacgctgttcggggtggacgcgatccagtaccgc
ctggccaacagcggcgcggcggcgctggtgaccgacgccgaaggctgccgcaagctgcgc
gagatccgcgccagcctgccggacctgaaggtggtctattgcatcgacccggactgcccg
gacgacgccgtgccgttccacgccgcgctggcggccgaatccgacgattacacgccggcg
gcgaccgcggccgacgacccggccgtcatcatctatacctcgggcaccaccggcaagccc
aagggcgcgctgcatgcgcaccgggtgttgctgggccacctgccgggcgtggagatgtcg
cacgagttcttcccggaaaacgccgcgctgatgtggacgccggccgactgggcctggatc
ggcggcctgctggacgtgttgttgccgtcctggcatcacggcgtgccggtgctggcgcgc
cgcttcgagaaattcgacggcgccagcgccttcgagctgatggcgcgccacggcgtgacc
cacaccttcctgccgccgaccgcgctgaagatgatgcgcggcaccgagcttcccgccggg
gccggcgcgctggcgctgcgctcggtcgccagcggcggcgagtcgctgggagcggaactc
atcgattggggccggcgcgtgctgggcgtgaccatcaacgagttctacggccagaccgaa
tgcaacatgctggtgtcgtcctgctcgtccctgttcgacccctgcatcggcgccattggc
cgcgcggcgccgggccaccgcgttgctattgtggatgacagtggcgtcgaagtggcggat
ggacaggagggcaatatcggcgtattgcgcccagacccagtgatgttcctggggtactgg
aacaaccccgaggccaccgccgaaaagttcgcgggcgactatctgctgaccggcgaccag
ggcgtgcgcgacgccgagggcttcatccgcttcgtcggccgcaacgacgacgtcatcacc
agcgccggctaccgcatcggccctggcccgatcgaggactgcctgatcggccaccccgcg
gtgcgcatggcggcggtggttggcgtgcctgacgcccagcgcaccgagatcgtgatggcc
tatgtggtgctgaacgaaggctacgagggtaacgacgcgttggtgaaggatcttcaagcc
catgtgcgcaagcgcctggcggcccatgagtatccgcgcgcgatccgatttgtaaccagt
ttgccaaccactgccaccggcaagatcatccgccgcgagttgcgcgacggcagctactcc
tga

DBGET integrated database retrieval system