KEGG   Achromobacter xylosoxidans A8: AXYL_04497Help
Entry
AXYL_04497        CDS       T01341                                 

Definition
(GenBank) acetyl-CoA acetyltransferase family protein 4
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00072  Synthesis and degradation of ketone bodies
axy00280  Valine, leucine and isoleucine degradation
axy00310  Lysine degradation
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00620  Pyruvate metabolism
axy00630  Glyoxylate and dicarboxylate metabolism
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00900  Terpenoid backbone biosynthesis
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
axy01212  Fatty acid metabolism
axy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXYL_04497
   00630 Glyoxylate and dicarboxylate metabolism
    AXYL_04497
   00640 Propanoate metabolism
    AXYL_04497
   00650 Butanoate metabolism
    AXYL_04497
  Lipid metabolism
   00071 Fatty acid degradation
    AXYL_04497
   00072 Synthesis and degradation of ketone bodies
    AXYL_04497
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_04497
   00310 Lysine degradation
    AXYL_04497
   00380 Tryptophan metabolism
    AXYL_04497
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXYL_04497
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04497
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AXYL_04497
Enzymes [BR:axy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXYL_04497
Exosome [BR:axy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXYL_04497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADP17816
UniProt: E3HH02
Position
4821434..4822729
Genome map
AA seq 431 aa AA seqDB search
MAFKPVYVVDGARTPFLKARTGPGPFAAGDLAVQAGRALLLRQPHAPTDLDEVIVGCAAP
SPDEVNIGRVIALRLGCGNKVPGWTVMRNCASGMQALDSAIANIQSGRSELVLAGGTDAL
SRAPVLYSDEMVRWLASWYAARGMGAKLAALGRFRLRNLAPVIGLLKGLTDPVVGLSMGQ
TAENVATRFGIDRAAMDAYAAQSHARALAARAAGALGEISPLIDTQGKLYPDDDGVRDDS
TPEKLAKLKPVFDKPWGNITAGNSSQVTDGAAMLTLASEEAVRKWNLRPLGRIVDSQWAG
LDPAQMGLGPVHAATPILQRHGLGLNDLDLWEINEAFAAQVLGCLAAWRDDAYCQEHFGT
PAWGDLDPARLNVDGGAIAIGHPVGASGARIVLHLLAALKRRGARRGMAAICIGGGQGGA
MLVETLDEDRP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcattcaaaccggtttacgtcgtcgacggcgcccgcacgcctttcctgaaggcgcgc
accggcccaggccccttcgccgccggcgatctcgcagtgcaggccgggcgcgccctgctg
ctgcgccagccccatgcgcccacggacctggacgaggtcatcgtgggctgcgccgcgccg
tcccccgacgaagtgaacatcggccgcgtgatcgcgctgcgcctgggctgcggcaacaag
gtgccgggctggaccgtcatgcgcaattgcgcatccggcatgcaggcgctggattccgcc
atcgccaacatccagtccggccgttccgaactggtgctggccggcggcacggatgccctg
tcgcgcgcgccggtgctgtactcggacgagatggtgcgctggctggccagttggtatgcc
gcccgcggcatgggcgccaagctcgcggcattgggccgcttccgactgcgcaaccttgcg
cccgtcatcggcctgctcaagggcctgacggacccggtggtcggcctgtccatgggacag
accgccgagaacgtcgcgacccgcttcggcatcgaccgcgcggcgatggacgcctatgcg
gcccagagccatgcgcgcgcgctggcggcccgcgcggccggcgcgctgggcgagatctcg
ccgctgatcgacacgcaaggcaagctctatcccgacgacgatggcgtgcgcgacgactcc
acgcccgaaaaactcgccaagctcaaacccgtgttcgacaagccctggggcaacatcacc
gcgggcaacagctcgcaagtgacggacggcgccgccatgctcacgctcgcttccgaggaa
gcggtgcgcaaatggaacttgcggccgctgggccgcatcgtcgacagccagtgggccggc
ctcgatcccgcgcagatgggcctgggtccggtacatgcggccacacccatcctgcaacgc
cacggcctgggcctcaatgacctggacttgtgggagatcaacgaggccttcgccgcccag
gtgttaggctgcctggcggcctggcgcgacgatgcctattgccaggagcatttcggcacg
ccggcctggggcgacctcgatccggcccggctcaacgtcgatggcggcgcaatcgccatc
gggcatcccgtgggcgcttccggcgcccgcatcgtgctgcacctgctcgcggccctgaag
cgccgcggcgccagacgcggcatggcggccatctgcatcggcggcggccaaggcggcgcg
atgctggtcgaaaccctggacgaggaccgcccatga

DBGET integrated database retrieval system