KEGG   Achromobacter xylosoxidans A8: AXYL_04498
Entry
AXYL_04498        CDS       T01341                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein 22
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00280  Valine, leucine and isoleucine degradation
axy00281  Geraniol degradation
axy00310  Lysine degradation
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00410  beta-Alanine metabolism
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00903  Limonene and pinene degradation
axy00930  Caprolactam degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01200  Carbon metabolism
axy01212  Fatty acid metabolism
Module
axy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_04498
   00650 Butanoate metabolism
    AXYL_04498
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_04498
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_04498
   00310 Lysine degradation
    AXYL_04498
   00380 Tryptophan metabolism
    AXYL_04498
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_04498
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_04498
   00281 Geraniol degradation
    AXYL_04498
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04498
   00930 Caprolactam degradation
    AXYL_04498
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AXYL_04498
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_04498
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AXYL_04498
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 AlaDh_PNT_C NAD_binding_2 Pyr_redox_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: ADP17817
UniProt: E3HH03
Position
4822726..4824684
AA seq 652 aa
MTTLDTLSHWRLDRDTDGLAWLTFDRAGSAVNALSADTMGELAVVLDALDAVPPAGLIIQ
SGKATGFIVGADVNEFASLDTPEQARALVARGWNLFNRLAAVRYPTLALIQGHCLGGGLE
LALACRYRLVADQPGTSLALPEVMLGIFPGWGGMLRLPQLIGAPAALDMMLTGRGADARR
AAALGLADARVPPRLLLAAARQTVLSRKAPRRARGFGGWANRWPLKAIVASRARKQIAAK
DPLGHYPAAPAIVDIWEKHGGNALQAPALIDRIISSDTARNLLRVFRLQDRLKANGKQAG
IAPARHVHVVGAGVMGGDIAAWCALKGMTVTLQDQDMARIAPAIKRAAQLYSRRLKDPRL
ARAAFDRLMPDPAGGGVPLADIVIEAISEQPEAKRALYRSLEPRMKADALLATNTSSLAL
ETLRAGLAHPERLVGIHFFNPAAKMPLVEVVHAEGDAGDAQARACAFVGQIDKLALPVKS
APGFLVNAVLAPYMLEAMRSVDEGLAPEAVDAAMVAFGMPMGPLELADTVGLDIARAAGE
ELAGGAEPPRCLAERLARGDLGKKSGRGFYIWRDGKPAKGASPAGAPAGLAQRLIQPLID
ATRQRVDAGIVADADLADAGVIFGTGFAPFTGGPLHYQSSKALRDIRPAEAD
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgacgacactggatacgctatcccactggcgcctggaccgcgataccgacggcctggcg
tggctgaccttcgaccgcgccggcagcgcggtcaatgccttgtccgccgacaccatgggc
gagctggcggtggtgctggatgcgctggacgcagtcccgcccgcggggttgatcatccag
tccggcaaggccacgggcttcatcgtgggcgccgacgtcaatgaattcgccagcctggac
acgccggaacaggcgcgcgcgctggtcgcgcgcggctggaatctcttcaaccgcctggcc
gcggtgcgctatccgacgctggcgctgatccagggccactgcctgggcggcggcctggag
ctggcgctggcctgccgctaccggctggtggcggaccagcccggcacctcgctcgcgctg
cccgaagtgatgctggggattttccccggctggggcggcatgctgcgcctgccgcaactg
ataggcgcgcccgccgcgctcgacatgatgctgaccggccgcggcgccgacgcgcgccgc
gccgccgcattgggtcttgccgacgcgcgcgtgccgccgcgcctgctgctggccgccgcg
cgccagacggtgctgtcgcgcaaggcgccgcgccgcgcgcgcggcttcggcggctgggcc
aaccgctggccgctcaaggccatcgtcgccagccgcgcccgcaagcagatcgccgccaag
gatccgctgggccactatcccgccgcgcccgccatcgtcgatatctgggaaaaacacggc
ggcaacgccctgcaggcgcccgcgctgatcgaccgcatcatttcctccgacaccgcccgc
aacctgctgcgggtgttccgcctgcaggaccggctgaaggccaacggcaaacaggccggc
atcgcgcccgcgcgccatgtgcacgtggtgggcgccggggtgatgggcggcgatatcgcc
gcctggtgcgcgctcaagggcatgacggtcaccttgcaggaccaggacatggcgcgcatc
gcgccggccatcaagcgcgccgcccagctgtactcgcgccgcctgaaggatccgcggctg
gcgcgcgcggcgttcgaccgcctgatgcccgacccggcgggcggcggcgtgccgctggcc
gacatcgtcatcgaagccatcagcgaacagcccgaggccaaacgcgcgctctaccgttcg
ctggaaccgcgcatgaaggccgatgccctgctcgccaccaacacctccagcctggcactg
gagaccttgcgcgcaggccttgcgcacccagaacgtctggtgggcatccacttcttcaat
cccgcggccaagatgcccctggtggaggtggtgcacgccgaaggcgacgcaggcgacgcg
caagcccgcgcctgcgccttcgtcgggcagatcgacaagctggcgctgccggtcaagagc
gcgccgggcttcctggtcaacgccgtgctggcgccctatatgctggaggccatgcgcagc
gtggatgaaggcttggcgcccgaggccgtggacgcggccatggtcgccttcggcatgccg
atgggaccgctggagctggcagataccgtgggcttggacatcgcgcgcgcggcaggcgag
gaacttgctggcggcgccgagccgccgcgctgcctggccgagcgcctggcgcgcggcgac
ctgggcaagaagagcggccgcggcttctacatctggcgcgacggcaagccggccaagggc
gccagccccgccggcgcgcccgccggactggcgcagcgcctgatccagccgctgatagac
gccacgcgccagcgcgtggacgcgggcatcgtcgccgacgccgacctggcggacgcgggc
gtgattttcggaacggggttcgcgccattcacgggcggccccttgcattaccagagcagt
aaagcattgcgcgatataagaccggctgaggccgattag

DBGET integrated database retrieval system