KEGG   Achromobacter xylosoxidans A8: AXYL_05134Help
Entry
AXYL_05134        CDS       T01341                                 

Gene name
ntrB
Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00910  Nitrogen metabolism
axy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AXYL_05134 (ntrB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AXYL_05134 (ntrB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axy02000]
    AXYL_05134 (ntrB)
Transporters [BR:axy02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter
    AXYL_05134 (ntrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADP18440
UniProt: E3HRG2
Position
complement(5503820..5504650)
Genome map
AA seq 276 aa AA seqDB search
MSSVTTMSRGDEFIALWRERLELALRAVVGPVAGFALFVLVWQVVALRIPEIPTPGVTWR
AAVELFSDPFYDNGPNDKGIGWNLLASLERVAIGFGLAALIGIPAGFAIGRYAAVRAMFS
PIVSLLRPVSPLAWLPLGLLLFKAANPAAIWAIFICSIWPMIINTAVGVSRVPQDYLNVA
RVLNLSEWKVTTKVLLPAVLPYVLTGVRLSIGTAWLVIVAAEMLTGGTGIGFWLWDEWNN
LKVEHIVIAIFVIGIVGLLLETLLVALARRFTYTEE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcgtaacgacgatgagccgcggcgatgaattcattgccctttggcgtgaacgc
ctggagctcgcgctgcgggccgtggtagggcccgtggcgggcttcgcattgtttgtgctg
gtgtggcaggtggtggcgctgcggataccggaaattcccacgcccggcgtcacctggcgc
gcggccgtcgaactcttttccgatccgttctacgacaacggcccgaatgacaaaggcata
ggctggaacctgctggcatcgctggaacgcgtggcgatcggcttcggcctggccgcgctg
atcgggattccggcgggtttcgccatcggccgctatgcggcggtgcgggccatgttctcg
cccatcgtcagcctgctgcggccggtgtcgccgctggcgtggctgccgctggggctgttg
ctgttcaaggcggccaacccggccgccatctgggccattttcatctgttcgatctggccc
atgatcatcaacaccgcggtcggcgtgtcgcgcgtgccgcaggactacctgaacgtggcg
cgggtgctgaacctgtccgaatggaaagtaaccaccaaggtgctgctgcccgccgtgctg
ccctacgtgctgaccggcgtgcggctgtccatcggcaccgcctggctggtgatcgtggcg
gcggaaatgctgaccggcggcaccggcattggcttctggctctgggacgaatggaacaac
ctgaaagtggagcacatcgtcatcgcgattttcgtgatcggcatcgtggggctgctactg
gaaaccctgctggtcgccctggcccgccgtttcacctataccgaggaatag

DBGET integrated database retrieval system