KEGG   Achromobacter xylosoxidans A8: AXYL_05396Help
Entry
AXYL_05396        CDS       T01341                                 

Definition
(GenBank) acetyl-CoA acetyltransferase family protein 7
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00071  Fatty acid degradation
axy00072  Synthesis and degradation of ketone bodies
axy00280  Valine, leucine and isoleucine degradation
axy00310  Lysine degradation
axy00362  Benzoate degradation
axy00380  Tryptophan metabolism
axy00620  Pyruvate metabolism
axy00630  Glyoxylate and dicarboxylate metabolism
axy00640  Propanoate metabolism
axy00650  Butanoate metabolism
axy00900  Terpenoid backbone biosynthesis
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
axy01212  Fatty acid metabolism
axy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXYL_05396
   00630 Glyoxylate and dicarboxylate metabolism
    AXYL_05396
   00640 Propanoate metabolism
    AXYL_05396
   00650 Butanoate metabolism
    AXYL_05396
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXYL_05396
   00072 Synthesis and degradation of ketone bodies
    AXYL_05396
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_05396
   00310 Lysine degradation
    AXYL_05396
   00380 Tryptophan metabolism
    AXYL_05396
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXYL_05396
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_05396
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXYL_05396
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axy04147]
    AXYL_05396
Enzymes [BR:axy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXYL_05396
Exosome [BR:axy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXYL_05396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ADP18696
UniProt: E3HVC3
Position
5772121..5773302
Genome map
AA seq 393 aa AA seqDB search
MREAVIVATARTPLTKSKRGEFNITQGPTLASYAIQAAVERAGVDPHSIEDVVLGCGYPE
GTTGRNVARQAALRAGLPQSVAGATVNRFCASGLQAVADAAARVVMGQSGPVVAGGVESC
SLLRTRDDGVSGIDSWLQDQIPGLYLPMIATADIVAQRYGISREDQDAFALRSQQLTAAA
QREGRYADEIISVRATMEITDKATGEIRREDVTVSADNCNRASTTAEGLAGLVPVMGPDR
YVTAGNASQLADGASACVLMDARDAERANLEPLGAFRGLAVAGCAPDEMGIGPVYAVPRL
LERHGLKVEDIDLWELNEAFASQALYCQRRLGIPLERLNVNGGSIAVGHPFGVTGARLTG
HVLLEGRRRGAKYAVVTMCVGGGMGAAGLFEIF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagccgtcatcgtcgccaccgcgcgcacgccgctcaccaagtccaagcgcggc
gagttcaacatcacccaggggccgaccctggcctcttacgccatccaggcagccgtggaa
cgcgcgggcgtggatccgcacagcatcgaagacgtggtgctgggctgcggctacccggaa
ggcaccaccggccgcaacgtggcccgccaggcggcgttgcgcgccggcctgccgcaaagc
gtcgccggcgccaccgtcaaccgcttctgcgcctccggcctgcaggccgtggccgatgcg
gcggcgcgcgtggtcatgggccaatccggcccggtcgtagccggcggcgtggaaagctgc
tcgctgctgcgcacccgcgacgacggcgtcagcggcatcgatagctggctgcaggaccag
atccccggcctctacctgcccatgatcgccaccgccgatatcgtggcgcagcgctacggc
atcagccgcgaggatcaggacgcctttgccttgcgcagccagcagctcaccgccgcggcg
cagcgcgaaggccgctatgccgacgagatcatttccgtgcgcgccaccatggaaattacc
gacaaggcgacgggcgagattcgccgcgaagacgtcaccgtcagcgccgacaactgcaac
cgcgcgtccaccaccgccgaaggcctggccggtctggttcccgtcatgggcccggaccgc
tacgtgaccgcgggcaatgcctcgcagctggccgacggcgcctcggcctgcgtgctgatg
gacgcccgcgacgccgaacgcgccaacctcgaaccgctgggcgccttccgcggcttggcc
gtggccggctgcgctcccgatgaaatggggataggcccggtctacgccgtgccccgcctg
ctggagcgccacggtctgaaggtcgaggacatcgacctgtgggagctgaacgaggccttc
gcctcgcaggcgctgtactgccagcgccgtctgggcatcccgctggagcggctcaacgtc
aacggcggttcgatcgcggtgggccatcccttcggcgtgaccggcgcgcgcctgaccggc
catgtcctgctggaaggcaggcgccgtggcgccaagtatgcggtggtcaccatgtgcgtg
ggcggcggcatgggcgcggcggggttgttcgagatcttctga

DBGET integrated database retrieval system