KEGG   Achromobacter xylosoxidans A8: AXYL_05693
Entry
AXYL_05693        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
axy  Achromobacter xylosoxidans A8
Brite
KEGG Orthology (KO) [BR:axy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:axy02044]
    AXYL_05693
Secretion system [BR:axy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AXYL_05693
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADP18992
UniProt: E3HG89
Position
complement(6117067..6117591)
AA seq 174 aa
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVGDFSAQSEAELPRLKDR
KFVNIDVDNFDDVMRGLEPRAAYRVKNRLTDEGGTFGVDLKFRSVEDFRPEAVVQQIEPL
KELLDIRTKLADLRNKLAGNDKLEDLLGEVLSSTEKLQQLTSEAGKNGKGGSNE
NT seq 525 nt   +upstreamnt  +downstreamnt
atggctaagaaagaaagcgttcagaaaagactccagaaagtacgtccgccgcgcgtgcag
ctgacctatgacgtcgaaaagggcgacgcgatcgagcagaaggaactgcctttcgtcgtg
ggcgtggtcggcgatttcagcgcgcagtccgaagccgaactgccgcgcctgaaggaccgc
aagttcgtcaacatcgacgtcgacaacttcgacgacgtgatgcgcggcctggaaccgcgc
gccgcctaccgcgtgaagaaccgcctgaccgacgaaggcggcaccttcggcgtggacctg
aagttccgttcggtcgaggacttccgcccggaagcggtggtgcagcagatcgagccgctc
aaggagctcctggacatccgcaccaagctggccgacctgcgcaacaagctggccggcaac
gacaagctggaagacctgctgggtgaagtgctcagcagcacggaaaaactgcagcaactg
accagcgaagccggcaagaacggcaagggaggcagcaatgagtaa

DBGET integrated database retrieval system